Organism Overview: Natronomonas moolapensis


 
oapC protein networkhttps://string-db.org/network/268739.Nmlp_1001Origin-associated protein OapC.
oapB protein networkhttps://string-db.org/network/268739.Nmlp_1002Origin-associated protein OapB.
oapA protein networkhttps://string-db.org/network/268739.Nmlp_1003Origin-associated GTP-binding protein OapA.
orc1 protein networkhttps://string-db.org/network/268739.Nmlp_1004Orc1-type DNA replication protein; Involved in regulation of DNA replication.
Nmlp_1005 protein networkhttps://string-db.org/network/268739.Nmlp_1005Uncharacterized protein.
Nmlp_1007 protein networkhttps://string-db.org/network/268739.Nmlp_1007Alpha/beta hydrolase fold protein.
sufS2 protein networkhttps://string-db.org/network/268739.Nmlp_1008Probable cysteine desulfurase.
Nmlp_1009 protein networkhttps://string-db.org/network/268739.Nmlp_1009Small CPxCG-related zinc finger protein.
Nmlp_1010 protein networkhttps://string-db.org/network/268739.Nmlp_1010Small CPxCG-related zinc finger protein.
rpiA protein networkhttps://string-db.org/network/268739.Nmlp_1011Ribose-5-phosphate isomerase; Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate.
Nmlp_1012 protein networkhttps://string-db.org/network/268739.Nmlp_1012IS1341-type transposase ISNamo20.
Nmlp_1013 protein networkhttps://string-db.org/network/268739.Nmlp_1013Uncharacterized protein.
purE2 protein networkhttps://string-db.org/network/268739.Nmlp_1014PurE family protein.
Nmlp_1015 protein networkhttps://string-db.org/network/268739.Nmlp_1015Small CPxCG-related zinc finger protein.
Nmlp_1016 protein networkhttps://string-db.org/network/268739.Nmlp_1016UPF0213 family protein.
amzA protein networkhttps://string-db.org/network/268739.Nmlp_1017Archaemetzincin; Probable zinc metalloprotease whose natural substrate is unknown.
Nmlp_1018 protein networkhttps://string-db.org/network/268739.Nmlp_1018UPF0146 family protein; Belongs to the UPF0146 family.
Nmlp_1019 protein networkhttps://string-db.org/network/268739.Nmlp_1019HAD superfamily hydrolase.
npdG protein networkhttps://string-db.org/network/268739.Nmlp_1020F420H2:NADP oxidoreductase.
Nmlp_1021 protein networkhttps://string-db.org/network/268739.Nmlp_1021PrsW family protein.
aubA protein networkhttps://string-db.org/network/268739.Nmlp_1022RNA-binding protein AU-1; Probable RNase involved in rRNA stability through maturation and/or degradation of precursor rRNAs. Binds to RNA in loop regions with AU-rich sequences.
Nmlp_1023 protein networkhttps://string-db.org/network/268739.Nmlp_1023Stomatin family protein.
Nmlp_1024 protein networkhttps://string-db.org/network/268739.Nmlp_1024Uncharacterized protein.
Nmlp_1025 protein networkhttps://string-db.org/network/268739.Nmlp_1025Major facilitator superfamily transport protein.
pyrD protein networkhttps://string-db.org/network/268739.Nmlp_1026Dihydroorotate dehydrogenase (quinone); Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor; Belongs to the dihydroorotate dehydrogenase family. Type 2 subfami [...]
Nmlp_1027 protein networkhttps://string-db.org/network/268739.Nmlp_1027Uncharacterized protein.
Nmlp_1028 protein networkhttps://string-db.org/network/268739.Nmlp_1028Nonhistone chromosomal protein.
Nmlp_1029 protein networkhttps://string-db.org/network/268739.Nmlp_1029Uncharacterized protein.
ridA protein networkhttps://string-db.org/network/268739.Nmlp_1030Enamine/imine deaminase.
Nmlp_1031 protein networkhttps://string-db.org/network/268739.Nmlp_1031DEAD/DEAH box helicase.
lipA protein networkhttps://string-db.org/network/268739.Nmlp_1032Lipoate synthase; Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, ther [...]
Nmlp_1033 protein networkhttps://string-db.org/network/268739.Nmlp_1033Acetyltransferase domain protein.
lysC protein networkhttps://string-db.org/network/268739.Nmlp_1034Aspartate kinase; Belongs to the aspartokinase family.
Nmlp_1035 protein networkhttps://string-db.org/network/268739.Nmlp_1035TIGR00725 family protein.
Nmlp_1036 protein networkhttps://string-db.org/network/268739.Nmlp_1036ABC-type transport system ATP-binding/permease protein.
ipp2 protein networkhttps://string-db.org/network/268739.Nmlp_1037Inorganic pyrophosphatase; Catalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions.
Nmlp_1038 protein networkhttps://string-db.org/network/268739.Nmlp_1038Uncharacterized protein.
cbiA protein networkhttps://string-db.org/network/268739.Nmlp_1039Cobyrinate a,c-diamide synthase.
cobT protein networkhttps://string-db.org/network/268739.Nmlp_1040Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase; Belongs to the UPF0284 family.
Nmlp_1041 protein networkhttps://string-db.org/network/268739.Nmlp_1041UPF0104 family protein.
gtl6 protein networkhttps://string-db.org/network/268739.Nmlp_1042Probable glycosyltransferase, type 2.
Nmlp_1043 protein networkhttps://string-db.org/network/268739.Nmlp_1043AlkP-core domain protein.
cbiE protein networkhttps://string-db.org/network/268739.Nmlp_1044Cobalt-precorrin-7 C5-methyltransferase.
cbiC protein networkhttps://string-db.org/network/268739.Nmlp_1045Cobalt-precorrin-8 methylmutase.
cobN protein networkhttps://string-db.org/network/268739.Nmlp_1046ATP-dependent cobaltochelatase subunit CobN.
chlID protein networkhttps://string-db.org/network/268739.Nmlp_1047ATP-dependent cobaltochelatase subunit ChlID.
Nmlp_1048 protein networkhttps://string-db.org/network/268739.Nmlp_1048CbtB family protein.
Nmlp_1049 protein networkhttps://string-db.org/network/268739.Nmlp_1049CbtA family protein.
Nmlp_1050 protein networkhttps://string-db.org/network/268739.Nmlp_1050Thioredoxin domain protein.
Nmlp_1051 protein networkhttps://string-db.org/network/268739.Nmlp_1051Uncharacterized protein.
rtcB2 protein networkhttps://string-db.org/network/268739.Nmlp_1052tRNA-splicing ligase RtcB.
aspC4 protein networkhttps://string-db.org/network/268739.Nmlp_1053Pyridoxal phosphate-dependent aminotransferase.
Nmlp_1054 protein networkhttps://string-db.org/network/268739.Nmlp_1054GNAT family acetyltransferase.
Nmlp_1055 protein networkhttps://string-db.org/network/268739.Nmlp_1055Uncharacterized protein.
Nmlp_1056 protein networkhttps://string-db.org/network/268739.Nmlp_1056DUF302 family protein.
Nmlp_1057 protein networkhttps://string-db.org/network/268739.Nmlp_1057Uncharacterized protein.
Nmlp_1058 protein networkhttps://string-db.org/network/268739.Nmlp_1058Uncharacterized protein.
Nmlp_1059 protein networkhttps://string-db.org/network/268739.Nmlp_1059Uncharacterized protein.
Nmlp_1060 protein networkhttps://string-db.org/network/268739.Nmlp_10604-phosphopantoate--beta-alanine ligase.
Nmlp_1061 protein networkhttps://string-db.org/network/268739.Nmlp_1061Uncharacterized protein.
Nmlp_1062 protein networkhttps://string-db.org/network/268739.Nmlp_1062DUF82 family protein.
polX protein networkhttps://string-db.org/network/268739.Nmlp_1063DNA-directed DNA polymerase X.
Nmlp_1064 protein networkhttps://string-db.org/network/268739.Nmlp_1064Uncharacterized protein.
ubaA protein networkhttps://string-db.org/network/268739.Nmlp_1065SAMP-activating enzyme E1.
hcp4 protein networkhttps://string-db.org/network/268739.Nmlp_1066Halocyanin.
msrB protein networkhttps://string-db.org/network/268739.Nmlp_1067Peptide methionine sulfoxide reductase MsrB (R-form specific).
Nmlp_1068 protein networkhttps://string-db.org/network/268739.Nmlp_1068Uncharacterized protein.
cat1 protein networkhttps://string-db.org/network/268739.Nmlp_1069Transport protein (probable substrate cationic amino acids).
Nmlp_1071 protein networkhttps://string-db.org/network/268739.Nmlp_1071UspA domain protein.
msrA1 protein networkhttps://string-db.org/network/268739.Nmlp_1072Peptide methionine sulfoxide reductase MsrA (S-form specific); Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidatio [...]
Nmlp_1073 protein networkhttps://string-db.org/network/268739.Nmlp_1073UspA domain protein.
Nmlp_1074 protein networkhttps://string-db.org/network/268739.Nmlp_1074Uncharacterized protein.
azf protein networkhttps://string-db.org/network/268739.Nmlp_1075Glucose-6-phosphate 1-dehydrogenase (NAD); Catalyzes the NAD-dependent oxidation of glucose 6-phosphate to 6-phosphogluconolactone; Belongs to the NAD(P)-dependent epimerase/dehydratase family.
Nmlp_1076 protein networkhttps://string-db.org/network/268739.Nmlp_1076Small CPxCG-related zinc finger protein.
Nmlp_1077 protein networkhttps://string-db.org/network/268739.Nmlp_1077ABC-type transport system permease protein (probable substrate macrolides).
Nmlp_1078 protein networkhttps://string-db.org/network/268739.Nmlp_1078ABC-type transport system ATP-binding protein (probable substrate macrolides).
Nmlp_1079 protein networkhttps://string-db.org/network/268739.Nmlp_1079Uncharacterized protein.
Nmlp_1080 protein networkhttps://string-db.org/network/268739.Nmlp_1080DUF309 family protein.
Nmlp_1081 protein networkhttps://string-db.org/network/268739.Nmlp_1081GNAT family acetyltransferase.
samp2 protein networkhttps://string-db.org/network/268739.Nmlp_1082Ubiquitin-like modifier protein SAMP2.
Nmlp_1083 protein networkhttps://string-db.org/network/268739.Nmlp_1083DUF583 domain protein.
rfcA protein networkhttps://string-db.org/network/268739.Nmlp_1084Replication factor C small subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcS subfamily.
Nmlp_1085 protein networkhttps://string-db.org/network/268739.Nmlp_1085Helicase domain protein.
Nmlp_1086 protein networkhttps://string-db.org/network/268739.Nmlp_1086Major facilitator superfamily transport protein.
Nmlp_1087 protein networkhttps://string-db.org/network/268739.Nmlp_1087Pyridoxal phosphate-dependent aminotransferase.
ligA protein networkhttps://string-db.org/network/268739.Nmlp_1088DNA ligase (NAD); DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double- stranded DNA using NAD as a coenzyme and as the energy [...]
Nmlp_1089 protein networkhttps://string-db.org/network/268739.Nmlp_1089Uncharacterized protein.
radA protein networkhttps://string-db.org/network/268739.Nmlp_1090DNA repair and recombination protein RadA; Involved in DNA repair and in homologous recombination. Binds and assemble on single-stranded DNA to form a nucleoprotein filament. Hydrolyzes ATP in a [...]
Nmlp_1091 protein networkhttps://string-db.org/network/268739.Nmlp_1091Uncharacterized protein.
Nmlp_1092 protein networkhttps://string-db.org/network/268739.Nmlp_1092FMN-binding domain protein.
rnr protein networkhttps://string-db.org/network/268739.Nmlp_1093Ribonuclease R.
Nmlp_1094 protein networkhttps://string-db.org/network/268739.Nmlp_1094Small CPxCG-related zinc finger protein.
pepB2 protein networkhttps://string-db.org/network/268739.Nmlp_1095Aminopeptidase (homolog to leucyl aminopeptidase.
Nmlp_1096 protein networkhttps://string-db.org/network/268739.Nmlp_1096IS1341-type transposase ISNamo20.
fdfT protein networkhttps://string-db.org/network/268739.Nmlp_1097Squalene synthase.
CoaE protein networkhttps://string-db.org/network/268739.Nmlp_1098UPF0200 family protein.
Nmlp_1099 protein networkhttps://string-db.org/network/268739.Nmlp_1099UPF0201 family protein; Belongs to the UPF0201 family.
Nmlp_1100 protein networkhttps://string-db.org/network/268739.Nmlp_1100Stomatin family protein.
Nmlp_1101 protein networkhttps://string-db.org/network/268739.Nmlp_1101HTH domain protein.
Nmlp_1102 protein networkhttps://string-db.org/network/268739.Nmlp_1102Uncharacterized protein.
Nmlp_1103 protein networkhttps://string-db.org/network/268739.Nmlp_1103TRAM domain protein.
Nmlp_1104 protein networkhttps://string-db.org/network/268739.Nmlp_1104Uncharacterized protein.
Nmlp_1105 protein networkhttps://string-db.org/network/268739.Nmlp_1105Uncharacterized protein.
pabB protein networkhttps://string-db.org/network/268739.Nmlp_1106Aminodeoxychorismate synthase component 1.
pabA protein networkhttps://string-db.org/network/268739.Nmlp_1107Aminodeoxychorismate synthase component 2.
pabC protein networkhttps://string-db.org/network/268739.Nmlp_1108Aminodeoxychorismate lyase; Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
Nmlp_1109 protein networkhttps://string-db.org/network/268739.Nmlp_1109Probable iron-sulfur protein (2Fe-2S).
Nmlp_1110 protein networkhttps://string-db.org/network/268739.Nmlp_1110Sensor/bat box HTH-10 family transcription regulator.
maeB1 protein networkhttps://string-db.org/network/268739.Nmlp_1111Malate dehydrogenase (oxaloacetate-decarboxylating).
ark protein networkhttps://string-db.org/network/268739.Nmlp_1112Receiver/sensor box histidine kinase.
Nmlp_1113 protein networkhttps://string-db.org/network/268739.Nmlp_1113Major facilitator superfamily transport protein.
Nmlp_1114 protein networkhttps://string-db.org/network/268739.Nmlp_1114DUF81 family protein.
trm1 protein networkhttps://string-db.org/network/268739.Nmlp_1115tRNA (guanine(26)-N(2))-dimethyltransferase; Dimethylates a single guanine residue at position 26 of a number of tRNAs using S-adenosyl-L-methionine as donor of the methyl groups; Belongs to the [...]
Nmlp_1116 protein networkhttps://string-db.org/network/268739.Nmlp_1116AbrB family transcription regulator.
Nmlp_1117 protein networkhttps://string-db.org/network/268739.Nmlp_1117Uncharacterized protein.
cxp1 protein networkhttps://string-db.org/network/268739.Nmlp_1118Metal-dependent carboxypeptidase; Broad specificity carboxypetidase that releases amino acids sequentially from the C-terminus, including neutral, aromatic, polar and basic residues.
Nmlp_1119 protein networkhttps://string-db.org/network/268739.Nmlp_1119arNOG04375 family protein (homolog to PilT-type ATPase).
Nmlp_1120 protein networkhttps://string-db.org/network/268739.Nmlp_1120Uncharacterized protein.
adkA protein networkhttps://string-db.org/network/268739.Nmlp_1121Adenylate kinase (ATP-AMP transphosphorylase),archaeal-type; Belongs to the archaeal adenylate kinase family.
Nmlp_1122 protein networkhttps://string-db.org/network/268739.Nmlp_1122FAD-dependent oxidoreductase (GlcD/DLD_GlcF/GlpC domain fusion protein).
Nmlp_1123 protein networkhttps://string-db.org/network/268739.Nmlp_1123Uncharacterized protein.
Nmlp_1124 protein networkhttps://string-db.org/network/268739.Nmlp_1124SWIM zinc finger domain protein.
tbp1 protein networkhttps://string-db.org/network/268739.Nmlp_1125TATA-binding transcription initiation factor; General factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Binds specifically to the TATA box promoter eleme [...]
Nmlp_1127 protein networkhttps://string-db.org/network/268739.Nmlp_1127Lactate 2-monooxygenase.
hisG protein networkhttps://string-db.org/network/268739.Nmlp_1128ATP phosphoribosyltransferase; Catalyzes the condensation of ATP and 5-phosphoribose 1- diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP). Has a crucial role in the pathway because the rate [...]
Nmlp_1129 protein networkhttps://string-db.org/network/268739.Nmlp_1129Protein kinase domain protein.
Nmlp_1130 protein networkhttps://string-db.org/network/268739.Nmlp_1130Uncharacterized protein.
Nmlp_1131 protein networkhttps://string-db.org/network/268739.Nmlp_1131Small CPxCG-related zinc finger protein.
Nmlp_1132 protein networkhttps://string-db.org/network/268739.Nmlp_1132Uncharacterized protein.
mer protein networkhttps://string-db.org/network/268739.Nmlp_1133Probable 5,10-methylenetetrahydrofolate reductase; Catalyzes the oxidation of methyl-H(4)MPT to methylene- H(4)MPT.
cofE protein networkhttps://string-db.org/network/268739.Nmlp_1134Coenzyme F420:L-glutamate ligase; Catalyzes the GTP-dependent successive addition of two or more gamma-linked L-glutamates to the L-lactyl phosphodiester of 7,8- didemethyl-8-hydroxy-5-deazaribof [...]
aroE protein networkhttps://string-db.org/network/268739.Nmlp_1135Shikimate dehydrogenase; Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshiki [...]
dtdA protein networkhttps://string-db.org/network/268739.Nmlp_1136D-aminoacyl-tRNA deacylase; D-aminoacyl-tRNA deacylase with broad substrate specificity. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxici [...]
cysA protein networkhttps://string-db.org/network/268739.Nmlp_1137ABC-type transport system ATP-binding protein (probable substrate sulfate/thiosulfate/molybdate).
Nmlp_1138 protein networkhttps://string-db.org/network/268739.Nmlp_1138ABC-type transport system permease protein (probable substrate sulfate/thiosulfate/molybdate).
Nmlp_1139 protein networkhttps://string-db.org/network/268739.Nmlp_1139ABC-type transport system periplasmic substrate-binding protein (probable substrate sulfate/thiosulfate/molybdate).
Nmlp_1140 protein networkhttps://string-db.org/network/268739.Nmlp_1140Uncharacterized protein.
Nmlp_1141 protein networkhttps://string-db.org/network/268739.Nmlp_1141Uncharacterized protein.
Nmlp_1142 protein networkhttps://string-db.org/network/268739.Nmlp_1142UPF0395 family protein.
Nmlp_1143 protein networkhttps://string-db.org/network/268739.Nmlp_1143UPF0395 family protein.
Nmlp_1144 protein networkhttps://string-db.org/network/268739.Nmlp_1144Uncharacterized protein.
Nmlp_1146 protein networkhttps://string-db.org/network/268739.Nmlp_1146Nucleotidyltransferase domain protein; Product: uncharacterized protein (nonfunctional).
Nmlp_1147 protein networkhttps://string-db.org/network/268739.Nmlp_1147Uncharacterized protein.
Nmlp_1148 protein networkhttps://string-db.org/network/268739.Nmlp_1148RelE family protein.
Nmlp_1149 protein networkhttps://string-db.org/network/268739.Nmlp_1149Uncharacterized protein.
Nmlp_1150 protein networkhttps://string-db.org/network/268739.Nmlp_1150Uncharacterized protein.
Nmlp_1151 protein networkhttps://string-db.org/network/268739.Nmlp_1151Uncharacterized protein.
Nmlp_1152 protein networkhttps://string-db.org/network/268739.Nmlp_1152Probable secreted glycoprotein.
ftsZ1 protein networkhttps://string-db.org/network/268739.Nmlp_1153Cell division protein FtsZ, type I; Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls [...]
secE protein networkhttps://string-db.org/network/268739.Nmlp_1154Protein translocase subunit SecE; Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation.
spt5 protein networkhttps://string-db.org/network/268739.Nmlp_1155Transcription elongation factor Spt5; Stimulates transcription elongation; Belongs to the archaeal Spt5 family.
Nmlp_1156 protein networkhttps://string-db.org/network/268739.Nmlp_1156PHP domain protein.
Nmlp_1157 protein networkhttps://string-db.org/network/268739.Nmlp_1157DUF457 family protein.
CinA3 protein networkhttps://string-db.org/network/268739.Nmlp_1158Nicotinamide mononucleotide deamidase.
hisB protein networkhttps://string-db.org/network/268739.Nmlp_1159Imidazoleglycerol-phosphate dehydratase.
Nmlp_1160 protein networkhttps://string-db.org/network/268739.Nmlp_1160Uncharacterized protein.
hemQ protein networkhttps://string-db.org/network/268739.Nmlp_1161Heme-binding protein HemQ.
Nmlp_1162 protein networkhttps://string-db.org/network/268739.Nmlp_1162Uncharacterized protein.
Nmlp_1163 protein networkhttps://string-db.org/network/268739.Nmlp_1163Uncharacterized protein.
Nmlp_1164 protein networkhttps://string-db.org/network/268739.Nmlp_1164M50 family metalloprotease.
lysS protein networkhttps://string-db.org/network/268739.Nmlp_1165lysine--tRNA ligase; Belongs to the class-I aminoacyl-tRNA synthetase family.
pyrH protein networkhttps://string-db.org/network/268739.Nmlp_1166Uridylate kinase; Catalyzes the reversible phosphorylation of UMP to UDP.
moaE protein networkhttps://string-db.org/network/268739.Nmlp_1167Molybdopterin synthase catalytic subunit.
Nmlp_1168 protein networkhttps://string-db.org/network/268739.Nmlp_1168Uncharacterized protein.
Nmlp_1169 protein networkhttps://string-db.org/network/268739.Nmlp_1169M50 family metalloprotease.
thiL protein networkhttps://string-db.org/network/268739.Nmlp_1170Thiamine-monophosphate kinase; Catalyzes the ATP-dependent phosphorylation of thiamine- monophosphate (TMP) to form thiamine-pyrophosphate (TPP), the active form of vitamin B1; Belongs to the thi [...]
rps19e protein networkhttps://string-db.org/network/268739.Nmlp_117130S ribosomal protein S19e; May be involved in maturation of the 30S ribosomal subunit. Belongs to the eukaryotic ribosomal protein eS19 family.
Nmlp_1172 protein networkhttps://string-db.org/network/268739.Nmlp_1172TIGR03663 family protein.
purK protein networkhttps://string-db.org/network/268739.Nmlp_11735-(carboxyamino)imidazole ribonucleotide synthase; Catalyzes the ATP-dependent conversion of 5-aminoimidazole ribonucleotide (AIR) and HCO(3)(-) to N5-carboxyaminoimidazole ribonucleotide (N5-CAI [...]
nosL1 protein networkhttps://string-db.org/network/268739.Nmlp_1174NosL family protein.
purE1 protein networkhttps://string-db.org/network/268739.Nmlp_1175N5-carboxyaminoimidazole ribonucleotide mutase; Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR).
taw2 protein networkhttps://string-db.org/network/268739.Nmlp_1176tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase; S-adenosyl-L-methionine-dependent transferase that acts as a component of the wyosine derivatives biosynthesis pathway. Catal [...]
Nmlp_1177 protein networkhttps://string-db.org/network/268739.Nmlp_1177NMD3 family protein.
Nmlp_1178 protein networkhttps://string-db.org/network/268739.Nmlp_1178Major facilitator superfamily transport protein.
ribE protein networkhttps://string-db.org/network/268739.Nmlp_1179Riboflavin synthase.
Nmlp_1180 protein networkhttps://string-db.org/network/268739.Nmlp_1180Uncharacterized protein.
Nmlp_1181 protein networkhttps://string-db.org/network/268739.Nmlp_1181Uncharacterized protein.
truA protein networkhttps://string-db.org/network/268739.Nmlp_1182tRNA pseudouridine synthase TruA.
pepF protein networkhttps://string-db.org/network/268739.Nmlp_1183Oligoendopeptidase PepF.
pan1 protein networkhttps://string-db.org/network/268739.Nmlp_1184Proteasome-activating nucleotidase; ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is esse [...]
Nmlp_1185 protein networkhttps://string-db.org/network/268739.Nmlp_1185Uncharacterized protein.
Nmlp_1186 protein networkhttps://string-db.org/network/268739.Nmlp_1186Small CPxCG-related zinc finger protein.
ilvE1 protein networkhttps://string-db.org/network/268739.Nmlp_1187Branched-chain amino acid aminotransferase; Acts on leucine, isoleucine and valine. Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
menG protein networkhttps://string-db.org/network/268739.Nmlp_1188Probable demethylmenaquinone methyltransferase.
Nmlp_1189 protein networkhttps://string-db.org/network/268739.Nmlp_1189DUF1628 domain protein.
Nmlp_1190 protein networkhttps://string-db.org/network/268739.Nmlp_1190Uncharacterized protein.
Nmlp_1191 protein networkhttps://string-db.org/network/268739.Nmlp_1191Probable transmembrane glycoprotein / HTH domain protein.
etfB protein networkhttps://string-db.org/network/268739.Nmlp_1192Electron transfer flavoprotein beta subunit.
etfA protein networkhttps://string-db.org/network/268739.Nmlp_1193Electron transfer flavoprotein alpha subunit.
trpC protein networkhttps://string-db.org/network/268739.Nmlp_1194Indole-3-glycerol-phosphate synthase; Belongs to the TrpC family.
trpB1 protein networkhttps://string-db.org/network/268739.Nmlp_1195Tryptophan synthase beta subunit; The beta subunit is responsible for the synthesis of L- tryptophan from indole and L-serine.
trpA protein networkhttps://string-db.org/network/268739.Nmlp_1196Tryptophan synthase alpha subunit; The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate. Belongs to the TrpA family.
fba2 protein networkhttps://string-db.org/network/268739.Nmlp_11972-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase.
cspA4 protein networkhttps://string-db.org/network/268739.Nmlp_1198Cold shock protein.
Nmlp_1200 protein networkhttps://string-db.org/network/268739.Nmlp_1200HTH-10 family transcription regulator.
aroB protein networkhttps://string-db.org/network/268739.Nmlp_12013-dehydroquinate synthase, type II; Catalyzes the oxidative deamination and cyclization of 2- amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid (ADH) to yield 3- dehydroquinate (DHQ), which is fed i [...]
aroD protein networkhttps://string-db.org/network/268739.Nmlp_12023-dehydroquinate dehydratase; Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis- dehydration of 3-dehydroquinate (DH [...]
Nmlp_1203 protein networkhttps://string-db.org/network/268739.Nmlp_1203TRAM domain protein.
aglD protein networkhttps://string-db.org/network/268739.Nmlp_1204Glycosyltransferase AglD.
Nmlp_1205 protein networkhttps://string-db.org/network/268739.Nmlp_1205PQQ repeat protein.
LctP1 protein networkhttps://string-db.org/network/268739.Nmlp_1206LctP family transport protein.
Nmlp_1207 protein networkhttps://string-db.org/network/268739.Nmlp_1207HTH domain protein.
LctP2 protein networkhttps://string-db.org/network/268739.Nmlp_1208LctP family transport protein.
Nmlp_1209 protein networkhttps://string-db.org/network/268739.Nmlp_1209UCP012666 family protein.
tfbA4 protein networkhttps://string-db.org/network/268739.Nmlp_1210Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).
ilvA protein networkhttps://string-db.org/network/268739.Nmlp_1211Threonine ammonia-lyase.
NosY3 protein networkhttps://string-db.org/network/268739.Nmlp_1212ABC-type transport system permease protein.
NosF3 protein networkhttps://string-db.org/network/268739.Nmlp_1213ABC-type transport system ATP-binding protein.
pcn protein networkhttps://string-db.org/network/268739.Nmlp_1214DNA polymerase sliding clamp; Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA [...]
dsa protein networkhttps://string-db.org/network/268739.Nmlp_1215Dihydrolipoamide S-acyltransferase.
oxdhB protein networkhttps://string-db.org/network/268739.Nmlp_12162-oxo-3-methylvalerate dehydrogenase E1 component beta subunit.
oxdhA1 protein networkhttps://string-db.org/network/268739.Nmlp_12172-oxo-3-methylvalerate dehydrogenase E1 component alpha subunit.
Nmlp_1218 protein networkhttps://string-db.org/network/268739.Nmlp_1218Uncharacterized protein.
priL protein networkhttps://string-db.org/network/268739.Nmlp_1219DNA primase large subunit; Regulatory subunit of DNA primase, an RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. Stab [...]
Nmlp_1220 protein networkhttps://string-db.org/network/268739.Nmlp_1220Uncharacterized protein.
carS protein networkhttps://string-db.org/network/268739.Nmlp_1221CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol synthase; Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn- glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1- phosphate [...]
Nmlp_1222 protein networkhttps://string-db.org/network/268739.Nmlp_1222DUF502 family protein.
ubiA1 protein networkhttps://string-db.org/network/268739.Nmlp_1223UbiA family prenyltransferase.
Nmlp_1224 protein networkhttps://string-db.org/network/268739.Nmlp_1224TRAM domain protein.
tfx protein networkhttps://string-db.org/network/268739.Nmlp_1225Tfx-type DNA-binding protein.
Nmlp_1226 protein networkhttps://string-db.org/network/268739.Nmlp_1226Probable oxidoreductase (short-chain dehydrogenase family).
Nmlp_1227 protein networkhttps://string-db.org/network/268739.Nmlp_1227Uncharacterized protein.
rpa3 protein networkhttps://string-db.org/network/268739.Nmlp_1228Replication protein A.
rpap3 protein networkhttps://string-db.org/network/268739.Nmlp_1229Rpa-associated protein.
pibD protein networkhttps://string-db.org/network/268739.Nmlp_1230Prepilin/preflagellin peptidase.
Nmlp_1231 protein networkhttps://string-db.org/network/268739.Nmlp_1231Uncharacterized protein.
guaAa1 protein networkhttps://string-db.org/network/268739.Nmlp_1232GMP synthase (glutamine-hydrolyzing) subunit A; Catalyzes the synthesis of GMP from XMP.
Nmlp_1233 protein networkhttps://string-db.org/network/268739.Nmlp_1233Uncharacterized protein.
leuA2 protein networkhttps://string-db.org/network/268739.Nmlp_12342-isopropylmalate synthase / (R)-citramalate synthase; Belongs to the alpha-IPM synthase/homocitrate synthase family.
Nmlp_1235 protein networkhttps://string-db.org/network/268739.Nmlp_1235DUF192 family protein.
secG protein networkhttps://string-db.org/network/268739.Nmlp_1236Protein translocase subunit SecG; Involved in protein export. The function of the beta subunit is unknown, but it may be involved in stabilization of the trimeric complex.
trxA1 protein networkhttps://string-db.org/network/268739.Nmlp_1237Thioredoxin.
argF protein networkhttps://string-db.org/network/268739.Nmlp_1238Ornithine carbamoyltransferase.
argE protein networkhttps://string-db.org/network/268739.Nmlp_1239Acetylornithine deacetylase; Catalyzes the release of L-lysine from [LysW]-gamma-L-lysine and the release of L-ornithine from [LysW]-L-ornithine.
argD protein networkhttps://string-db.org/network/268739.Nmlp_1240Acetylornithine aminotransferase; Involved in both the arginine and lysine biosynthetic pathways; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. LysJ subfamily.
argB protein networkhttps://string-db.org/network/268739.Nmlp_1241Acetylglutamate kinase; Involved in both the arginine and lysine biosynthetic pathways. Phosphorylates the LysW-bound precursors glutamate (for arginine biosynthesis), respectively alpha-aminoadi [...]
argC protein networkhttps://string-db.org/network/268739.Nmlp_1242N-acetyl-gamma-glutamyl-phosphate reductase; Involved in both the arginine and lysine biosynthetic pathways; Belongs to the NAGSA dehydrogenase family. Type 1 subfamily. LysY sub-subfamily.
argX protein networkhttps://string-db.org/network/268739.Nmlp_1243Probable glutamate--argW ligase.
argW protein networkhttps://string-db.org/network/268739.Nmlp_1244Probable biosynthetic carrier protein ArgW.
argH protein networkhttps://string-db.org/network/268739.Nmlp_1245Argininosuccinate lyase.
argG protein networkhttps://string-db.org/network/268739.Nmlp_1246Argininosuccinate synthase; Belongs to the argininosuccinate synthase family. Type 1 subfamily.
Nmlp_1247 protein networkhttps://string-db.org/network/268739.Nmlp_1247DUF456 family protein.
Nmlp_1248 protein networkhttps://string-db.org/network/268739.Nmlp_1248PsiE domain protein.
Nmlp_1249 protein networkhttps://string-db.org/network/268739.Nmlp_1249Probable secreted glycoprotein.
Nmlp_1250 protein networkhttps://string-db.org/network/268739.Nmlp_1250Uncharacterized protein.
Nmlp_1251 protein networkhttps://string-db.org/network/268739.Nmlp_1251Phosphodiesterase domain protein.
Nmlp_1252 protein networkhttps://string-db.org/network/268739.Nmlp_1252Uncharacterized protein.
Nmlp_1253 protein networkhttps://string-db.org/network/268739.Nmlp_1253FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase).
hisE protein networkhttps://string-db.org/network/268739.Nmlp_1254phosphoribosyl-ATP pyrophosphatase.
Nmlp_1255 protein networkhttps://string-db.org/network/268739.Nmlp_1255DUF151 family protein.
pdxT protein networkhttps://string-db.org/network/268739.Nmlp_1256Pyridoxal 5'-phosphate synthase subunit PdxT; Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate. The resulting ammonia molecule [...]
Nmlp_1257 protein networkhttps://string-db.org/network/268739.Nmlp_1257MJ0936 family phosphodiesterase.
Nmlp_1258 protein networkhttps://string-db.org/network/268739.Nmlp_1258ArsR family transcription regulator.
Nmlp_1259 protein networkhttps://string-db.org/network/268739.Nmlp_1259Uncharacterized protein.
leuS protein networkhttps://string-db.org/network/268739.Nmlp_1260leucine--tRNA ligase; Belongs to the class-I aminoacyl-tRNA synthetase family.
Nmlp_1261 protein networkhttps://string-db.org/network/268739.Nmlp_1261Uncharacterized protein.
uvrC protein networkhttps://string-db.org/network/268739.Nmlp_1262UvrABC system protein C; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible [...]
Nmlp_1271 protein networkhttps://string-db.org/network/268739.Nmlp_1271Uncharacterized protein.
Nmlp_1272 protein networkhttps://string-db.org/network/268739.Nmlp_1272Uncharacterized protein.
Nmlp_1273 protein networkhttps://string-db.org/network/268739.Nmlp_1273Uncharacterized protein.
Nmlp_1274 protein networkhttps://string-db.org/network/268739.Nmlp_1274Uncharacterized protein.
tbp4 protein networkhttps://string-db.org/network/268739.Nmlp_1275TATA-binding transcription initiation factor.
Nmlp_1276 protein networkhttps://string-db.org/network/268739.Nmlp_1276Probable restriction/modification enzyme.
Nmlp_1277 protein networkhttps://string-db.org/network/268739.Nmlp_1277Probable DEAD/DEAH box helicase.
Nmlp_1278 protein networkhttps://string-db.org/network/268739.Nmlp_1278Small CPxCG-related zinc finger protein.
Nmlp_1280 protein networkhttps://string-db.org/network/268739.Nmlp_1280Uncharacterized protein.
Nmlp_1281 protein networkhttps://string-db.org/network/268739.Nmlp_1281Uncharacterized protein.
Nmlp_1282 protein networkhttps://string-db.org/network/268739.Nmlp_1282Uncharacterized protein.
Nmlp_1285 protein networkhttps://string-db.org/network/268739.Nmlp_1285IS1341-type transposase ISNamo19.
Nmlp_1286 protein networkhttps://string-db.org/network/268739.Nmlp_1286IS200-type transposase ISNamo19.
Nmlp_1287 protein networkhttps://string-db.org/network/268739.Nmlp_1287DUF151 family protein.
Nmlp_1288 protein networkhttps://string-db.org/network/268739.Nmlp_1288Uncharacterized protein.
Nmlp_1289 protein networkhttps://string-db.org/network/268739.Nmlp_1289Uncharacterized protein.
hop protein networkhttps://string-db.org/network/268739.Nmlp_1290Halorhodopsin.
blp protein networkhttps://string-db.org/network/268739.Nmlp_1291Blp-like protein.
blh protein networkhttps://string-db.org/network/268739.Nmlp_1292Beta-carotene 15,15'-dioxygenase Blh; Catalyzes the cleavage of beta-carotene at its central double bond (15,15') to yield two molecules of all-trans-retinal. Belongs to the Brp/Blh beta-carotene [...]
crtY protein networkhttps://string-db.org/network/268739.Nmlp_1293Lycopene beta-cyclase.
bat protein networkhttps://string-db.org/network/268739.Nmlp_1294HTH-type transcriptional regulator, bacterioopsin transcriptional activator and related proteins; Receiver/sensor/bat box HTH-10 family transcription regulator Bat (homolog to bacterioopsin activ [...]
Nmlp_1295 protein networkhttps://string-db.org/network/268739.Nmlp_1295UspA domain protein.
cre1 protein networkhttps://string-db.org/network/268739.Nmlp_1296Creatininase domain protein.
rpl16 protein networkhttps://string-db.org/network/268739.Nmlp_129750S ribosomal protein L16; Belongs to the universal ribosomal protein uL16 family.
ths2 protein networkhttps://string-db.org/network/268739.Nmlp_1298Thermosome subunit 2; Belongs to the TCP-1 chaperonin family.
Nmlp_1299 protein networkhttps://string-db.org/network/268739.Nmlp_1299Uncharacterized protein.
Nmlp_1300 protein networkhttps://string-db.org/network/268739.Nmlp_1300Uncharacterized protein.
Nmlp_1301 protein networkhttps://string-db.org/network/268739.Nmlp_1301Probable carbon-nitrogen hydrolase.
Nmlp_1302 protein networkhttps://string-db.org/network/268739.Nmlp_1302START domain protein.
Nmlp_1303 protein networkhttps://string-db.org/network/268739.Nmlp_1303HTH domain protein.
Nmlp_1304 protein networkhttps://string-db.org/network/268739.Nmlp_1304Uncharacterized protein.
Nmlp_1305 protein networkhttps://string-db.org/network/268739.Nmlp_1305Small CPxCG-related zinc finger protein.
Nmlp_1306 protein networkhttps://string-db.org/network/268739.Nmlp_1306DUF457 family protein.
atpD protein networkhttps://string-db.org/network/268739.Nmlp_1307A-type ATP synthase subunit D; Produces ATP from ADP in the presence of a proton gradient across the membrane.
atpB protein networkhttps://string-db.org/network/268739.Nmlp_1308A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.
atpA protein networkhttps://string-db.org/network/268739.Nmlp_1309A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta ch [...]
atpF protein networkhttps://string-db.org/network/268739.Nmlp_1310A-type ATP synthase subunit F; Produces ATP from ADP in the presence of a proton gradient across the membrane.
atpC protein networkhttps://string-db.org/network/268739.Nmlp_1311A-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane.
atpE protein networkhttps://string-db.org/network/268739.Nmlp_1312A-type ATP synthase subunit E; Produces ATP from ADP in the presence of a proton gradient across the membrane.
atpK protein networkhttps://string-db.org/network/268739.Nmlp_1313A-type ATP synthase subunit K.
atpI protein networkhttps://string-db.org/network/268739.Nmlp_1315A-type ATP synthase subunit I; Belongs to the V-ATPase 116 kDa subunit family.
atpH protein networkhttps://string-db.org/network/268739.Nmlp_1316A-type ATP synthase subunit H.
tif6 protein networkhttps://string-db.org/network/268739.Nmlp_1317Translation initiation factor aIF-6; Binds to the 50S ribosomal subunit and prevents its association with the 30S ribosomal subunit to form the 70S initiation complex.
rpl31e protein networkhttps://string-db.org/network/268739.Nmlp_131850S ribosomal protein L31e; Belongs to the ribosomal protein L31e family.
rpl39e protein networkhttps://string-db.org/network/268739.Nmlp_131950S ribosomal protein L39e; Belongs to the eukaryotic ribosomal protein eL39 family.
Nmlp_1320 protein networkhttps://string-db.org/network/268739.Nmlp_1320TrmB family transcription regulator.
Nmlp_1321 protein networkhttps://string-db.org/network/268739.Nmlp_1321Oxidoreductase (homolog to thioredoxin-disulfide reductase).
Act protein networkhttps://string-db.org/network/268739.Nmlp_1322Thioesterase domain protein.
tatC2 protein networkhttps://string-db.org/network/268739.Nmlp_1323Sec-independent protein translocase subunit TatC; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...]
tatC1 protein networkhttps://string-db.org/network/268739.Nmlp_1324Sec-independent protein translocase subunit TatC; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...]
Nmlp_1325 protein networkhttps://string-db.org/network/268739.Nmlp_1325Homolog to S-adenosylmethionine-dependent methyltransferase.
gth4 protein networkhttps://string-db.org/network/268739.Nmlp_1326Probable glycosyltransferase, type 1.
Nmlp_1327 protein networkhttps://string-db.org/network/268739.Nmlp_1327PtpS family protein.
Nmlp_1328 protein networkhttps://string-db.org/network/268739.Nmlp_1328Oxidoreductase (homolog to zinc-containing alcohol dehydrogenase / threonine 3-dehydrogenase).
Nmlp_1329 protein networkhttps://string-db.org/network/268739.Nmlp_1329AlkP-core domain protein.
Nmlp_1330 protein networkhttps://string-db.org/network/268739.Nmlp_1330Probable oxidoreductase (aldo-keto reductase family protein).
Nmlp_1331 protein networkhttps://string-db.org/network/268739.Nmlp_1331Uncharacterized protein.
pgsA1 protein networkhttps://string-db.org/network/268739.Nmlp_1332CDP-alcohol 1-archaetidyltransferase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
Nmlp_1333 protein networkhttps://string-db.org/network/268739.Nmlp_1333DUF457 family protein.
purC protein networkhttps://string-db.org/network/268739.Nmlp_1334Phosphoribosylaminoimidazole-succinocarboxamide synthase; Belongs to the SAICAR synthetase family.
Nmlp_1335 protein networkhttps://string-db.org/network/268739.Nmlp_1335Uncharacterized protein; Product: IS200-type transposase NmIRS32 (nonfunctional).
Nmlp_1336 protein networkhttps://string-db.org/network/268739.Nmlp_1336PHP domain protein.
Nmlp_1337 protein networkhttps://string-db.org/network/268739.Nmlp_1337Uncharacterized protein.
phaB protein networkhttps://string-db.org/network/268739.Nmlp_13383-oxoacyl-CoA reductase (NADP).
Nmlp_1339 protein networkhttps://string-db.org/network/268739.Nmlp_1339Histidine kinase.
Nmlp_1340 protein networkhttps://string-db.org/network/268739.Nmlp_1340Uncharacterized protein.
nosD3 protein networkhttps://string-db.org/network/268739.Nmlp_1341ABC-type transport system periplasmic substrate-binding protein (probable substrate copper).
mtfK2 protein networkhttps://string-db.org/network/268739.Nmlp_1342FKBP-type peptidylprolyl isomerase.
CyaB protein networkhttps://string-db.org/network/268739.Nmlp_1343Adenylate cyclase domain protein.
mat protein networkhttps://string-db.org/network/268739.Nmlp_1344S-adenosylmethionine synthase; Catalyzes the formation of S-adenosylmethionine from methionine and ATP; Belongs to the AdoMet synthase 2 family.
Nmlp_1345 protein networkhttps://string-db.org/network/268739.Nmlp_1345Uncharacterized protein.
Nmlp_1346 protein networkhttps://string-db.org/network/268739.Nmlp_1346Uncharacterized protein.
pilB1 protein networkhttps://string-db.org/network/268739.Nmlp_1347Type IV pilus biogenesis complex ATPase subunit.
pilC1 protein networkhttps://string-db.org/network/268739.Nmlp_1348Type IV pilus biogenesis complex membrane subunit.
Nmlp_1349 protein networkhttps://string-db.org/network/268739.Nmlp_1349Probable S-adenosylmethionine-dependent methyltransferase.
Nmlp_1350 protein networkhttps://string-db.org/network/268739.Nmlp_1350DoxX domain protein.
Nmlp_1351 protein networkhttps://string-db.org/network/268739.Nmlp_1351DUF1405 family protein.
pdxS protein networkhttps://string-db.org/network/268739.Nmlp_1352Pyridoxal 5'-phosphate synthase subunit PdxS; Catalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provide [...]
Nmlp_1353 protein networkhttps://string-db.org/network/268739.Nmlp_1353DUF373 family protein.
nreA protein networkhttps://string-db.org/network/268739.Nmlp_1354DNA repair protein NreA; Involved in DNA damage repair.
rnhA2 protein networkhttps://string-db.org/network/268739.Nmlp_1355Ribonuclease H, type 1.
Nmlp_1356 protein networkhttps://string-db.org/network/268739.Nmlp_1356Uncharacterized protein.
ipp1 protein networkhttps://string-db.org/network/268739.Nmlp_1357Inorganic pyrophosphatase; Catalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions.
pilC2 protein networkhttps://string-db.org/network/268739.Nmlp_1358Type IV pilus biogenesis complex membrane subunit.
pilB2 protein networkhttps://string-db.org/network/268739.Nmlp_1359Type IV pilus biogenesis complex ATPase subunit.
Nmlp_1360 protein networkhttps://string-db.org/network/268739.Nmlp_1360Probable amidase.
Nmlp_1361 protein networkhttps://string-db.org/network/268739.Nmlp_1361UspA domain protein.
Nmlp_1362 protein networkhttps://string-db.org/network/268739.Nmlp_1362UspA domain protein.
jamm1 protein networkhttps://string-db.org/network/268739.Nmlp_1363Metalloprotease JAMM1, desampylating.
Nmlp_1364 protein networkhttps://string-db.org/network/268739.Nmlp_1364ABC-type transport system periplasmic substrate-binding protein (probable substrate iron/cobalamin).
argS protein networkhttps://string-db.org/network/268739.Nmlp_1365arginine--tRNA ligase; Belongs to the class-I aminoacyl-tRNA synthetase family.
taw1 protein networkhttps://string-db.org/network/268739.Nmlp_1366tRNA-(4-demethylwyosine) synthase, S-adenosyl-L-methionine-dependent; Component of the wyosine derivatives biosynthesis pathway that catalyzes the condensation of N-methylguanine with 2 carbon at [...]
ribK protein networkhttps://string-db.org/network/268739.Nmlp_1367Riboflavin kinase, CTP-dependent; Catalyzes the CTP-dependent phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN); Belongs to the archaeal riboflavin kinase family.
ribB protein networkhttps://string-db.org/network/268739.Nmlp_13683,4-dihydroxy-2-butanone 4-phosphate synthase; Catalyzes the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate.
rpa2 protein networkhttps://string-db.org/network/268739.Nmlp_1371Replication protein A.
hstA protein networkhttps://string-db.org/network/268739.Nmlp_1372Archaeal histone.
hda1 protein networkhttps://string-db.org/network/268739.Nmlp_1373HdaI-type histone deacetylase.
cca protein networkhttps://string-db.org/network/268739.Nmlp_1374tRNA adenylyltransferase, CCA-adding; Catalyzes the addition and repair of the essential 3'- terminal CCA sequence in tRNAs without using a nucleic acid template. Adds these three nucleotides in [...]
cbs2 protein networkhttps://string-db.org/network/268739.Nmlp_1377CBS domain protein.
glyS protein networkhttps://string-db.org/network/268739.Nmlp_1378glycine--tRNA ligase.
hef protein networkhttps://string-db.org/network/268739.Nmlp_1380ATP-dependent RNA helicase/nuclease Hef; Product: Kef-type transport system (probable substrate potassium) (nonfunctional).
Nmlp_1381 protein networkhttps://string-db.org/network/268739.Nmlp_1381UPF0148 family protein.
Nmlp_1382 protein networkhttps://string-db.org/network/268739.Nmlp_1382PUA domain protein.
sepF protein networkhttps://string-db.org/network/268739.Nmlp_1383Probable SepF protein.
Nmlp_1384 protein networkhttps://string-db.org/network/268739.Nmlp_1384DUF124 family protein.
Nmlp_1385 protein networkhttps://string-db.org/network/268739.Nmlp_1385MOSC domain protein.
Nmlp_1386 protein networkhttps://string-db.org/network/268739.Nmlp_1386Uncharacterized protein.
Nmlp_1387 protein networkhttps://string-db.org/network/268739.Nmlp_1387KaiC domain protein.
glpK2 protein networkhttps://string-db.org/network/268739.Nmlp_1388Glycerol kinase; Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn- glycerol 3-phosphate.
kdgK protein networkhttps://string-db.org/network/268739.Nmlp_13892-keto-3-deoxygluconate kinase; Belongs to the carbohydrate kinase PfkB family.
gnaD protein networkhttps://string-db.org/network/268739.Nmlp_1390D-gluconate dehydratase.
Nmlp_1391 protein networkhttps://string-db.org/network/268739.Nmlp_1391Uncharacterized protein.
kdgA protein networkhttps://string-db.org/network/268739.Nmlp_13922-dehydro-3-deoxy-(phospho)gluconate aldolase,archaeal-type.
Nmlp_1393 protein networkhttps://string-db.org/network/268739.Nmlp_1393HAD superfamily hydrolase.
gdh protein networkhttps://string-db.org/network/268739.Nmlp_1394Glucose 1-dehydrogenase; Catalyzes the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate via gluconolactone. Can utilize both NAD(+) and NADP(+) as electron acceptor. Is involved in the d [...]
trmB protein networkhttps://string-db.org/network/268739.Nmlp_1395TrmB family transcription regulator TrmB.
aldH2 protein networkhttps://string-db.org/network/268739.Nmlp_1397Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
pykA protein networkhttps://string-db.org/network/268739.Nmlp_1398Pyruvate kinase; Belongs to the pyruvate kinase family.
mgsA protein networkhttps://string-db.org/network/268739.Nmlp_1399Methylglyoxal synthase; Catalyzes the formation of methylglyoxal from dihydroxyacetone phosphate.
Nmlp_1402 protein networkhttps://string-db.org/network/268739.Nmlp_1402HAD superfamily hydrolase.
Nmlp_1403 protein networkhttps://string-db.org/network/268739.Nmlp_1403Uncharacterized protein.
Nmlp_1404 protein networkhttps://string-db.org/network/268739.Nmlp_1404Uncharacterized protein.
bdbC protein networkhttps://string-db.org/network/268739.Nmlp_1405Disulfide bond formation protein.
Nmlp_1406 protein networkhttps://string-db.org/network/268739.Nmlp_1406Sensor box protein.
Nmlp_1407 protein networkhttps://string-db.org/network/268739.Nmlp_1407Uncharacterized protein.
Nmlp_1408 protein networkhttps://string-db.org/network/268739.Nmlp_1408Uncharacterized protein.
Nmlp_1409 protein networkhttps://string-db.org/network/268739.Nmlp_1409Sensor box histidine kinase.
hadL protein networkhttps://string-db.org/network/268739.Nmlp_1410Haloacid dehalogenase, type II.
thpR protein networkhttps://string-db.org/network/268739.Nmlp_1411RNA 2',3'-cyclic phosphodiesterase; Hydrolyzes RNA 2',3'-cyclic phosphodiester to an RNA 2'- phosphomonoester; Belongs to the 2H phosphoesterase superfamily. ThpR family.
gndA protein networkhttps://string-db.org/network/268739.Nmlp_14126-phosphogluconate dehydrogenase (NAD-dependent, decarboxylating); Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of N [...]
Nmlp_1413 protein networkhttps://string-db.org/network/268739.Nmlp_1413Uncharacterized protein.
metY1 protein networkhttps://string-db.org/network/268739.Nmlp_1414O-acetylhomoserine aminocarboxypropyltransferase (methionine synthase).
metX protein networkhttps://string-db.org/network/268739.Nmlp_1415Homoserine O-acetyltransferase; Transfers an acetyl group from acetyl-CoA to L-homoserine, forming acetyl-L-homoserine.
Nmlp_1416 protein networkhttps://string-db.org/network/268739.Nmlp_1416PQQ repeat protein.
metY2 protein networkhttps://string-db.org/network/268739.Nmlp_1417O-acetylhomoserine aminocarboxypropyltransferase (methionine synthase).
serB protein networkhttps://string-db.org/network/268739.Nmlp_1420Phosphoserine phosphatase; This gene seems complete but lacks its stop codon so that the reading frame continues into an adjacent ISH element; locus_tag: Nmlp_1419; product: UspA domain protein ( [...]
serA1 protein networkhttps://string-db.org/network/268739.Nmlp_1421D-3-phosphoglycerate dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
arf1 protein networkhttps://string-db.org/network/268739.Nmlp_1422Peptide chain release factor aRF-1; Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA.
Nmlp_1423 protein networkhttps://string-db.org/network/268739.Nmlp_1423DUF373 family protein.
dph6 protein networkhttps://string-db.org/network/268739.Nmlp_1424Diphthamide biosynthesis protein Dph6.
graD protein networkhttps://string-db.org/network/268739.Nmlp_1425Sugar nucleotidyltransferase.
Nmlp_1426 protein networkhttps://string-db.org/network/268739.Nmlp_1426HTH domain protein.
Nmlp_1427 protein networkhttps://string-db.org/network/268739.Nmlp_1427AAA-type ATPase (MoxR subfamily).
Nmlp_1428 protein networkhttps://string-db.org/network/268739.Nmlp_1428Uncharacterized protein.
Nmlp_1429 protein networkhttps://string-db.org/network/268739.Nmlp_1429endoisopeptidase/DUF4129 domain protein.
tif1 protein networkhttps://string-db.org/network/268739.Nmlp_1430Translation initiation factor aIF-1 (SUI1 protein, bacterial-type IF3); Belongs to the SUI1 family.
Nmlp_1431 protein networkhttps://string-db.org/network/268739.Nmlp_1431Rhodanese domain protein.
Nmlp_1432 protein networkhttps://string-db.org/network/268739.Nmlp_1432DUF1628 domain protein.
Nmlp_1433 protein networkhttps://string-db.org/network/268739.Nmlp_1433NUDIX family hydrolase.
Nmlp_1434 protein networkhttps://string-db.org/network/268739.Nmlp_1434Uncharacterized protein.
Nmlp_1435 protein networkhttps://string-db.org/network/268739.Nmlp_1435Uncharacterized protein.
Nmlp_1436 protein networkhttps://string-db.org/network/268739.Nmlp_1436GNAT family acetyltransferase.
Nmlp_1437 protein networkhttps://string-db.org/network/268739.Nmlp_1437ISH14-type transposase ISNamo12.
Nmlp_1438 protein networkhttps://string-db.org/network/268739.Nmlp_1438IS1341-type transposase ISNamo22; Product: nitroreductase family protein (nonfunctional); part of the region does not belong to this CDS as coordinates speficy only the outer boundaries; gene has [...]
Nmlp_1439 protein networkhttps://string-db.org/network/268739.Nmlp_1439Uncharacterized protein.
nitB protein networkhttps://string-db.org/network/268739.Nmlp_1441Nitrilase.
Nmlp_1442 protein networkhttps://string-db.org/network/268739.Nmlp_1442DICT domain protein.
ftsY protein networkhttps://string-db.org/network/268739.Nmlp_1443Signal recognition particle receptor FtsY; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the signal [...]
pfdA protein networkhttps://string-db.org/network/268739.Nmlp_1444Prefoldin alpha subunit; Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding.
rpl20e protein networkhttps://string-db.org/network/268739.Nmlp_144550S ribosomal protein L20e.
Nmlp_1446 protein networkhttps://string-db.org/network/268739.Nmlp_1446Probable PAP2-type phosphatase.
Nmlp_1447 protein networkhttps://string-db.org/network/268739.Nmlp_1447UPF0761 family protein.
Nmlp_1448 protein networkhttps://string-db.org/network/268739.Nmlp_1448Pantoate kinase.
mrpE protein networkhttps://string-db.org/network/268739.Nmlp_1450Mrp-type sodium/proton antiporter system subunit E.
mrpF protein networkhttps://string-db.org/network/268739.Nmlp_1451Mrp-type sodium/proton antiporter system subunit F.
mrpG protein networkhttps://string-db.org/network/268739.Nmlp_1452Mrp-type sodium/proton antiporter system subunit G.
mrpB1 protein networkhttps://string-db.org/network/268739.Nmlp_1453Mrp-type sodium/proton antiporter system subunit B1.
mrpB2 protein networkhttps://string-db.org/network/268739.Nmlp_1454Mrp-type sodium/proton antiporter system subunit B2.
mrpC protein networkhttps://string-db.org/network/268739.Nmlp_1455Mrp-type sodium/proton antiporter system subunit C.
mrpD3 protein networkhttps://string-db.org/network/268739.Nmlp_1456Mrp-type sodium/proton antiporter system subunit D3.
mrpD1 protein networkhttps://string-db.org/network/268739.Nmlp_1457Mrp-type sodium/proton antiporter system subunit D1.
mrpD2 protein networkhttps://string-db.org/network/268739.Nmlp_1458Mrp-type sodium/proton antiporter system subunit D2.
Nmlp_1460 protein networkhttps://string-db.org/network/268739.Nmlp_1460Small CPxCG-related zinc finger protein; Gene is interrupted (frameshift,in-frame stop); locus_tag: Nmlp_1459; product: ISH14-type transposase NmIRS15 (nonfunctional); conceptual translation afte [...]
ashA protein networkhttps://string-db.org/network/268739.Nmlp_1461Archaea-specific helicase AshA.
Nmlp_1463 protein networkhttps://string-db.org/network/268739.Nmlp_1463HTH domain protein.
purA protein networkhttps://string-db.org/network/268739.Nmlp_1465Adenylosuccinate synthase; Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP; Belongs to the [...]
htr28 protein networkhttps://string-db.org/network/268739.Nmlp_1466Transducer protein Htr28.
idiA protein networkhttps://string-db.org/network/268739.Nmlp_1467Isopentenyl-diphosphate delta-isomerase, type I.
Nmlp_1468 protein networkhttps://string-db.org/network/268739.Nmlp_1468Uncharacterized protein.
Nmlp_1469 protein networkhttps://string-db.org/network/268739.Nmlp_1469PrpD family protein.
Nmlp_1470 protein networkhttps://string-db.org/network/268739.Nmlp_1470Uncharacterized protein.
qor1 protein networkhttps://string-db.org/network/268739.Nmlp_1471NADPH:quinone reductase.
moaB1 protein networkhttps://string-db.org/network/268739.Nmlp_1472Molybdopterin adenylyltransferase.
Nmlp_1473 protein networkhttps://string-db.org/network/268739.Nmlp_1473Cupin 2 barrel domain protein.
Nmlp_1474 protein networkhttps://string-db.org/network/268739.Nmlp_1474Uncharacterized protein.
cspA1 protein networkhttps://string-db.org/network/268739.Nmlp_1475Cold shock protein.
cynT protein networkhttps://string-db.org/network/268739.Nmlp_1476Carbonic anhydrase.
Nmlp_1477 protein networkhttps://string-db.org/network/268739.Nmlp_1477Uncharacterized protein.
Nmlp_1478 protein networkhttps://string-db.org/network/268739.Nmlp_1478YqjG-type gamma-glutamylcysteinyl-hydroquinone reductase.
dppF protein networkhttps://string-db.org/network/268739.Nmlp_1479ABC-type transport system ATP-binding protein (probable substrate dipeptide/oligopeptide).
dppD protein networkhttps://string-db.org/network/268739.Nmlp_1480ABC-type transport system ATP-binding protein (probable substrate dipeptide/oligopeptide).
dppC protein networkhttps://string-db.org/network/268739.Nmlp_1481ABC-type transport system permease protein (probable substrate dipeptide/oligopeptide).
dppB protein networkhttps://string-db.org/network/268739.Nmlp_1482ABC-type transport system permease protein (probable substrate dipeptide/oligopeptide).
dppA protein networkhttps://string-db.org/network/268739.Nmlp_1483ABC-type transport system periplasmic substrate-binding protein (probable substrate dipeptide/oligopeptide).
Nmlp_1484 protein networkhttps://string-db.org/network/268739.Nmlp_14842-haloacid dehalogenase family protein.
Nmlp_1485 protein networkhttps://string-db.org/network/268739.Nmlp_1485Uncharacterized protein.
Nmlp_1486 protein networkhttps://string-db.org/network/268739.Nmlp_1486Probable S-adenosylmethionine-dependent methyltransferase.
speB1 protein networkhttps://string-db.org/network/268739.Nmlp_1487Agmatinase; Belongs to the arginase family.
Nmlp_1488 protein networkhttps://string-db.org/network/268739.Nmlp_1488ArsR family transcription regulator.
Nmlp_1489 protein networkhttps://string-db.org/network/268739.Nmlp_1489Uncharacterized protein.
Nmlp_1490 protein networkhttps://string-db.org/network/268739.Nmlp_1490Uncharacterized protein.
Nmlp_1491 protein networkhttps://string-db.org/network/268739.Nmlp_1491Uncharacterized protein.
Nmlp_1492 protein networkhttps://string-db.org/network/268739.Nmlp_1492ArsR family transcription regulator.
Nmlp_1493 protein networkhttps://string-db.org/network/268739.Nmlp_1493Uncharacterized protein.
Nmlp_1494 protein networkhttps://string-db.org/network/268739.Nmlp_1494DUF162 family protein.
Nmlp_1495 protein networkhttps://string-db.org/network/268739.Nmlp_1495Probable iron-sulfur protein (4Fe-4S).
Nmlp_1496 protein networkhttps://string-db.org/network/268739.Nmlp_1496GNAT family acetyltransferase.
msrA2 protein networkhttps://string-db.org/network/268739.Nmlp_1497Peptide methionine sulfoxide reductase MsrA (S-form specific).
pimT2 protein networkhttps://string-db.org/network/268739.Nmlp_1498protein-L-isoaspartate O-methyltransferase.
pimT1 protein networkhttps://string-db.org/network/268739.Nmlp_1499protein-L-isoaspartate O-methyltransferase; Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl [...]
Nmlp_1500 protein networkhttps://string-db.org/network/268739.Nmlp_1500UCP015877 family protein.
pepB1 protein networkhttps://string-db.org/network/268739.Nmlp_1501Aminopeptidase (homolog to leucyl aminopeptidase.
gap protein networkhttps://string-db.org/network/268739.Nmlp_1502Glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (phosphorylating).
pchA2 protein networkhttps://string-db.org/network/268739.Nmlp_1503Ion channel pore / TrkA domain protein.
hsp20A protein networkhttps://string-db.org/network/268739.Nmlp_1504Hsp20-type molecular chaperone; Belongs to the small heat shock protein (HSP20) family.
Nmlp_1505 protein networkhttps://string-db.org/network/268739.Nmlp_1505Transport protein (probable substrate arsenite).
Nmlp_1506 protein networkhttps://string-db.org/network/268739.Nmlp_1506ArsR family transcription regulator.
Nmlp_1507 protein networkhttps://string-db.org/network/268739.Nmlp_1507P-type transport ATPase (probable substrate calcium/metal cation).
Nmlp_1509 protein networkhttps://string-db.org/network/268739.Nmlp_1509Uncharacterized protein.
Nmlp_1510 protein networkhttps://string-db.org/network/268739.Nmlp_1510IS1341-type transposase ISNamo18.
CCT61390.1 protein networkhttps://string-db.org/network/268739.Nmlp_1510AIS200-type transposase ISNamo18.
Nmlp_1511 protein networkhttps://string-db.org/network/268739.Nmlp_1511Adenine-specific DNA modification methylase.
Nmlp_1512 protein networkhttps://string-db.org/network/268739.Nmlp_1512ISH14-type transposase ISNamo10.
Nmlp_1513 protein networkhttps://string-db.org/network/268739.Nmlp_1513Uncharacterized protein.
Nmlp_1514 protein networkhttps://string-db.org/network/268739.Nmlp_1514HTH domain protein.
Nmlp_1515 protein networkhttps://string-db.org/network/268739.Nmlp_1515Probable oxidoreductase (Short-chain dehydrogenase family); Gene is interrupted (frameshift,insert) and is truncated at the N-terminus; product: IS1341-type transposase NmIRS65 (nonfunctional); l [...]
Nmlp_1516 protein networkhttps://string-db.org/network/268739.Nmlp_1516Small CPxCG-related zinc finger protein.
Nmlp_1517 protein networkhttps://string-db.org/network/268739.Nmlp_1517Major facilitator superfamily transport protein.
Nmlp_1518 protein networkhttps://string-db.org/network/268739.Nmlp_1518MJ0936 family phosphodiesterase.
Nmlp_1519 protein networkhttps://string-db.org/network/268739.Nmlp_1519Uncharacterized protein.
Nmlp_1520 protein networkhttps://string-db.org/network/268739.Nmlp_1520Small CPxCG-related zinc finger protein.
ilvD protein networkhttps://string-db.org/network/268739.Nmlp_1521Dihydroxy-acid dehydratase; Belongs to the IlvD/Edd family.
Nmlp_1522 protein networkhttps://string-db.org/network/268739.Nmlp_1522Iron-sulfur protein (4Fe-4S).
bioN protein networkhttps://string-db.org/network/268739.Nmlp_1523ABC-type transport system permease protein (probable substrate biotin).
bioM protein networkhttps://string-db.org/network/268739.Nmlp_1524ABC-type transport system ATP-binding protein (probable substrate biotin).
bioY protein networkhttps://string-db.org/network/268739.Nmlp_1525Biotin transport protein BioY.
Nmlp_1526 protein networkhttps://string-db.org/network/268739.Nmlp_1526Uncharacterized protein.
trxB2 protein networkhttps://string-db.org/network/268739.Nmlp_1527Thioredoxin-disulfide reductase.
arsA2 protein networkhttps://string-db.org/network/268739.Nmlp_1528ArsA family ATPase.
Nmlp_1529 protein networkhttps://string-db.org/network/268739.Nmlp_1529Oxidoreductase (homolog to thioredoxin-disulfide reductase).
phoU5 protein networkhttps://string-db.org/network/268739.Nmlp_1530PhoU domain protein.
Nmlp_1531 protein networkhttps://string-db.org/network/268739.Nmlp_1531Uncharacterized protein.
rad3a protein networkhttps://string-db.org/network/268739.Nmlp_1532DNA repair helicase Rad3.
Nmlp_1533 protein networkhttps://string-db.org/network/268739.Nmlp_1533DUF1684 family protein.
Nmlp_1534 protein networkhttps://string-db.org/network/268739.Nmlp_1534AlkP-core domain protein.
folA2 protein networkhttps://string-db.org/network/268739.Nmlp_1535Dihydrofolate reductase.
Nmlp_1536 protein networkhttps://string-db.org/network/268739.Nmlp_1536Probable S-adenosylmethionine-dependent methyltransferase (homolog to 24-sterol C-methyltransferase).
Nmlp_1538 protein networkhttps://string-db.org/network/268739.Nmlp_1538ISHwa16-type transposase ISNamo14; Gene has been targetted by a transposon; locus_tag: Nmlp_1537; product: ISH14-type transposase ISNamo8 (nonfunctional); conceptual translation after in silico r [...]
Nmlp_1540 protein networkhttps://string-db.org/network/268739.Nmlp_1540PQQ repeat protein.
Nmlp_1541 protein networkhttps://string-db.org/network/268739.Nmlp_1541Small CPxCG-related zinc finger protein.
dut protein networkhttps://string-db.org/network/268739.Nmlp_1542dUTP diphosphatase.
parA4 protein networkhttps://string-db.org/network/268739.Nmlp_1545ParA domain protein.
uraA1 protein networkhttps://string-db.org/network/268739.Nmlp_1546Xanthine/uracil permease family transport protein.
apt2 protein networkhttps://string-db.org/network/268739.Nmlp_1547Purine phosphoribosyltransferase (adenine phosphoribosyltransferase, xanthine-guanine phosphoribosyltransferase).
pyrE1 protein networkhttps://string-db.org/network/268739.Nmlp_1548Orotate phosphoribosyltransferase; Catalyzes the transfer of a ribosyl phosphate group from 5- phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).
tif1A1 protein networkhttps://string-db.org/network/268739.Nmlp_1549Translation initiation factor aIF-1A; Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-t [...]
Nmlp_1550 protein networkhttps://string-db.org/network/268739.Nmlp_1550Uncharacterized protein.
kae1 protein networkhttps://string-db.org/network/268739.Nmlp_1551KEOPS complex subunit Kae1/Bud32; Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of [...]
rps31e protein networkhttps://string-db.org/network/268739.Nmlp_155230S ribosomal protein S31e; Belongs to the eukaryotic ribosomal protein eS31 family.
rps24e protein networkhttps://string-db.org/network/268739.Nmlp_155330S ribosomal protein S24e; Belongs to the eukaryotic ribosomal protein eS24 family.
Nmlp_1554 protein networkhttps://string-db.org/network/268739.Nmlp_1554UPF0218 family protein; Catalyzes the GTP-dependent phosphorylation of the 3'- hydroxyl group of dephosphocoenzyme A to form coenzyme A (CoA).
spt4 protein networkhttps://string-db.org/network/268739.Nmlp_1555Transcription elongation factor Spt4; Stimulates transcription elongation; Belongs to the archaeal Spt4 family.
rpoE1 protein networkhttps://string-db.org/network/268739.Nmlp_1556DNA-directed RNA polymerase subunit E.
Nmlp_1557 protein networkhttps://string-db.org/network/268739.Nmlp_1557DUF188 family protein.
tif2c protein networkhttps://string-db.org/network/268739.Nmlp_1558Translation initiation factor aIF-2 gamma subunit; eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. Belongs to the TRAFAC class tr [...]
Nmlp_1559 protein networkhttps://string-db.org/network/268739.Nmlp_1559Uncharacterized protein.
maa2 protein networkhttps://string-db.org/network/268739.Nmlp_1560O-acetyltransferase (homolog to galactoside O-acetyltransferase).
Nmlp_1561 protein networkhttps://string-db.org/network/268739.Nmlp_1561Probable beta-carotene 15,15'-monooxygenase.
Nmlp_1562 protein networkhttps://string-db.org/network/268739.Nmlp_1562Tetratricopeptide repeat protein.
Nmlp_1563 protein networkhttps://string-db.org/network/268739.Nmlp_1563DUF424 family protein.
sppA2 protein networkhttps://string-db.org/network/268739.Nmlp_1565Signal peptide peptidase SppA.
Nmlp_1566 protein networkhttps://string-db.org/network/268739.Nmlp_1566GATase domain protein.
Nmlp_1567 protein networkhttps://string-db.org/network/268739.Nmlp_1567Histidine kinase.
sufS1 protein networkhttps://string-db.org/network/268739.Nmlp_1568Cysteine desulfurase.
iscU1 protein networkhttps://string-db.org/network/268739.Nmlp_1569Iron-sulfur cluster assembly protein.
panE protein networkhttps://string-db.org/network/268739.Nmlp_15702-dehydropantoate 2-reductase; Catalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid.
aor3 protein networkhttps://string-db.org/network/268739.Nmlp_1571Aldehyde ferredoxin oxidoreductase.
Nmlp_1572 protein networkhttps://string-db.org/network/268739.Nmlp_1572NifU C-terminal domain protein.
ahcY protein networkhttps://string-db.org/network/268739.Nmlp_1573Adenosylhomocysteinase; May play a key role in the regulation of the intracellular concentration of adenosylhomocysteine.
Nmlp_1574 protein networkhttps://string-db.org/network/268739.Nmlp_1574Uncharacterized protein.
mtaD protein networkhttps://string-db.org/network/268739.Nmlp_15755-methylthioadenosine/S-adenosylhomocysteine deaminase; Catalyzes the deamination of 5-methylthioadenosine and S- adenosyl-L-homocysteine into 5-methylthioinosine and S-inosyl-L- homocysteine, re [...]
Nmlp_1576 protein networkhttps://string-db.org/network/268739.Nmlp_1576Uncharacterized protein.
Nmlp_1577 protein networkhttps://string-db.org/network/268739.Nmlp_1577Thioesterase domein protein.
Nmlp_1578 protein networkhttps://string-db.org/network/268739.Nmlp_1578JAB domain protein.
Nmlp_1579 protein networkhttps://string-db.org/network/268739.Nmlp_1579SSSF family transport protein; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
phoU6 protein networkhttps://string-db.org/network/268739.Nmlp_1580PhoU domain protein.
Nmlp_1581 protein networkhttps://string-db.org/network/268739.Nmlp_1581Uncharacterized protein.
Nmlp_1582 protein networkhttps://string-db.org/network/268739.Nmlp_1582HTH domain protein.
Nmlp_1583 protein networkhttps://string-db.org/network/268739.Nmlp_1583Uncharacterized protein.
secY protein networkhttps://string-db.org/network/268739.Nmlp_1584Protein translocase subunit SecY; The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the [...]
rpl15 protein networkhttps://string-db.org/network/268739.Nmlp_158550S ribosomal protein L15; Binds to the 23S rRNA; Belongs to the universal ribosomal protein uL15 family.
rpl30 protein networkhttps://string-db.org/network/268739.Nmlp_158650S ribosomal protein L30.
rps5 protein networkhttps://string-db.org/network/268739.Nmlp_158730S ribosomal protein S5; Belongs to the universal ribosomal protein uS5 family.
rpl18 protein networkhttps://string-db.org/network/268739.Nmlp_158850S ribosomal protein L18; This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protubera [...]
rpl19e protein networkhttps://string-db.org/network/268739.Nmlp_158950S ribosomal protein L19e; Binds to the 23S rRNA; Belongs to the eukaryotic ribosomal protein eL19 family.
rpl32e protein networkhttps://string-db.org/network/268739.Nmlp_159050S ribosomal protein L32e; Belongs to the eukaryotic ribosomal protein eL32 family.
rpl6 protein networkhttps://string-db.org/network/268739.Nmlp_159150S ribosomal protein L6; This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the t [...]
rps8 protein networkhttps://string-db.org/network/268739.Nmlp_159230S ribosomal protein S8; One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit; Belongs to [...]
rps14 protein networkhttps://string-db.org/network/268739.Nmlp_159330S ribosomal protein S14; Binds 16S rRNA, required for the assembly of 30S particles.
rpl5 protein networkhttps://string-db.org/network/268739.Nmlp_159450S ribosomal protein L5; This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance [...]
rps4e protein networkhttps://string-db.org/network/268739.Nmlp_159530S ribosomal protein S4e; Belongs to the eukaryotic ribosomal protein eS4 family.
rpl24 protein networkhttps://string-db.org/network/268739.Nmlp_159650S ribosomal protein L24; Located at the polypeptide exit tunnel on the outside of the subunit.
rpl14 protein networkhttps://string-db.org/network/268739.Nmlp_159750S ribosomal protein L14; Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome; Belongs to the universal ribosomal protein uL14 family.
rps17 protein networkhttps://string-db.org/network/268739.Nmlp_159830S ribosomal protein S17; One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.
rnp1 protein networkhttps://string-db.org/network/268739.Nmlp_1599Ribonuclease P protein component 1; Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends; Belongs to the eukaryotic/archaeal RNase P protein co [...]
rpl29 protein networkhttps://string-db.org/network/268739.Nmlp_160050S ribosomal protein L29; Belongs to the universal ribosomal protein uL29 family.
rps3 protein networkhttps://string-db.org/network/268739.Nmlp_160130S ribosomal protein S3; Binds the lower part of the 30S subunit head. Belongs to the universal ribosomal protein uS3 family.
rpl22 protein networkhttps://string-db.org/network/268739.Nmlp_160250S ribosomal protein L22; The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wal [...]
rps19 protein networkhttps://string-db.org/network/268739.Nmlp_160330S ribosomal protein S19; Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA.
rpl2 protein networkhttps://string-db.org/network/268739.Nmlp_160450S ribosomal protein L2; One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It [...]
rpl23 protein networkhttps://string-db.org/network/268739.Nmlp_160550S ribosomal protein L23; Binds to 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Belongs to the universal ribosomal protein uL23 family [...]
rpl4 protein networkhttps://string-db.org/network/268739.Nmlp_160650S ribosomal protein L4; Forms part of the polypeptide exit tunnel.
rpl3 protein networkhttps://string-db.org/network/268739.Nmlp_160750S ribosomal protein L3; One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit; Belongs to the universal rib [...]
Nmlp_1608 protein networkhttps://string-db.org/network/268739.Nmlp_1608DUF171 family protein.
Nmlp_1610 protein networkhttps://string-db.org/network/268739.Nmlp_1610Uncharacterized protein; Product: IS1341-type transposase NmIRS30 (nonfunctional).
Nmlp_1611 protein networkhttps://string-db.org/network/268739.Nmlp_1611UPF0045 family protein.
Nmlp_1612 protein networkhttps://string-db.org/network/268739.Nmlp_1612DUF2150 family protein.
Nmlp_1613 protein networkhttps://string-db.org/network/268739.Nmlp_1613Probable secreted glycoprotein.
Nmlp_1614 protein networkhttps://string-db.org/network/268739.Nmlp_1614Uncharacterized protein.
Nmlp_1615 protein networkhttps://string-db.org/network/268739.Nmlp_1615DUF3368 domain protein.
Nmlp_1616 protein networkhttps://string-db.org/network/268739.Nmlp_1616UPF0175 family protein.
Nmlp_1617 protein networkhttps://string-db.org/network/268739.Nmlp_1617DUF433 domain protein.
Nmlp_1618 protein networkhttps://string-db.org/network/268739.Nmlp_1618Uncharacterized protein.
hmgB protein networkhttps://string-db.org/network/268739.Nmlp_1619hydroxymethylglutaryl-CoA synthase.
htr1T protein networkhttps://string-db.org/network/268739.Nmlp_1620Sensory rhodopsin I transducer transmembrane region.
Nmlp_1621 protein networkhttps://string-db.org/network/268739.Nmlp_1621Integrase family protein.
Nmlp_1622 protein networkhttps://string-db.org/network/268739.Nmlp_1622Uncharacterized protein.
Nmlp_1623 protein networkhttps://string-db.org/network/268739.Nmlp_1623Uncharacterized protein.
Nmlp_1625 protein networkhttps://string-db.org/network/268739.Nmlp_1625ISH10-type transposase ISNamo3.
Nmlp_1626 protein networkhttps://string-db.org/network/268739.Nmlp_1626ISHwa16-type transposase ISNamo14.
Nmlp_1628 protein networkhttps://string-db.org/network/268739.Nmlp_1628ISHwa16-type transposase ISNamo15.
Nmlp_1630 protein networkhttps://string-db.org/network/268739.Nmlp_1630ISHwa16-type transposase ISNamo14.
Nmlp_1632 protein networkhttps://string-db.org/network/268739.Nmlp_1632Receiver/sensor box histidine kinase.
Nmlp_1633 protein networkhttps://string-db.org/network/268739.Nmlp_1633Sensor box histidine kinase.
Nmlp_1636 protein networkhttps://string-db.org/network/268739.Nmlp_1636Sensor box histidine kinase; Product: IS1341-type transposase NmIRS72 (nonfunctional).
hemAT1 protein networkhttps://string-db.org/network/268739.Nmlp_1637Transducer protein HemAT.
Nmlp_1639 protein networkhttps://string-db.org/network/268739.Nmlp_1639DUF2800 family protein; Product: ISH8-type transposase NmIRS8 (nonfunctional).
Nmlp_1640 protein networkhttps://string-db.org/network/268739.Nmlp_1640Small CPxCG-related zinc finger protein.
Nmlp_1641 protein networkhttps://string-db.org/network/268739.Nmlp_1641Small CPxCG-related zinc finger protein.
Nmlp_1642 protein networkhttps://string-db.org/network/268739.Nmlp_1642DUF790 family protein.
rad25b protein networkhttps://string-db.org/network/268739.Nmlp_1643DNA repair helicase Rad25.
Nmlp_1644 protein networkhttps://string-db.org/network/268739.Nmlp_1644Uncharacterized protein.
Nmlp_1645 protein networkhttps://string-db.org/network/268739.Nmlp_1645Probable secreted glycoprotein.
Nmlp_1646 protein networkhttps://string-db.org/network/268739.Nmlp_1646XerC/D-like integrase.
Nmlp_1647 protein networkhttps://string-db.org/network/268739.Nmlp_1647ISH14-type transposase ISNamo13.
purL protein networkhttps://string-db.org/network/268739.Nmlp_1648Phosphoribosylformylglycinamidine synthase subunit PurL; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent c [...]
Nmlp_1649 protein networkhttps://string-db.org/network/268739.Nmlp_1649PHP domain protein.
asnB protein networkhttps://string-db.org/network/268739.Nmlp_1650Asparagine synthase (glutamine-hydrolyzing).
Nmlp_1651 protein networkhttps://string-db.org/network/268739.Nmlp_1651Uncharacterized protein.
tfbA2 protein networkhttps://string-db.org/network/268739.Nmlp_1652Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).
Nmlp_1653 protein networkhttps://string-db.org/network/268739.Nmlp_1653HTH domain protein.
gatC protein networkhttps://string-db.org/network/268739.Nmlp_1654aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu [...]
gatA protein networkhttps://string-db.org/network/268739.Nmlp_1655aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack [...]
Nmlp_1656 protein networkhttps://string-db.org/network/268739.Nmlp_1656Abi/CAAX domain protein.
Nmlp_1657 protein networkhttps://string-db.org/network/268739.Nmlp_1657Uncharacterized protein.
parA5 protein networkhttps://string-db.org/network/268739.Nmlp_1658ParA domain protein.
hit2 protein networkhttps://string-db.org/network/268739.Nmlp_1659Histidine triad family protein (homolog to bis(5'-nucleosyl)-tetraphosphatase).
Nmlp_1660 protein networkhttps://string-db.org/network/268739.Nmlp_1660Uncharacterized protein.
Nmlp_1661 protein networkhttps://string-db.org/network/268739.Nmlp_1661Uncharacterized protein.
Nmlp_1662 protein networkhttps://string-db.org/network/268739.Nmlp_1662Rhomboid family protease.
nfi protein networkhttps://string-db.org/network/268739.Nmlp_1663Endonuclease 5; DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the int [...]
Nmlp_1664 protein networkhttps://string-db.org/network/268739.Nmlp_1664Probable oxidoreductase (short-chain dehydrogenase family); Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Nmlp_1665 protein networkhttps://string-db.org/network/268739.Nmlp_1665DUF4147 domain protein.
arsA1 protein networkhttps://string-db.org/network/268739.Nmlp_1666ArsA family ATPase.
Nmlp_1667 protein networkhttps://string-db.org/network/268739.Nmlp_1667arCOG06342 family protein.
scpA protein networkhttps://string-db.org/network/268739.Nmlp_1668Chromosome segregation and condensation protein ScpA.
smc protein networkhttps://string-db.org/network/268739.Nmlp_1669Chromosome segregation protein Smc; Required for chromosome condensation and partitioning. Belongs to the SMC family.
Nmlp_1670 protein networkhttps://string-db.org/network/268739.Nmlp_1670Uncharacterized protein.
hisS protein networkhttps://string-db.org/network/268739.Nmlp_1671histidine--tRNA ligase; Belongs to the class-II aminoacyl-tRNA synthetase family.
purU protein networkhttps://string-db.org/network/268739.Nmlp_1672Formyltetrahydrofolate deformylase.
Nmlp_1675 protein networkhttps://string-db.org/network/268739.Nmlp_1675Probable oxidoreductase (Aldo-keto reductase family protein); Product: thioredoxin domain protein (nonfunctional).
maa1 protein networkhttps://string-db.org/network/268739.Nmlp_1676O-acetyltransferase (homolog to galactoside O-acetyltransferase).
acd1 protein networkhttps://string-db.org/network/268739.Nmlp_1677acyl-CoA dehydrogenase.
Nmlp_1678 protein networkhttps://string-db.org/network/268739.Nmlp_1678ISH14-type transposase ISNamo8.
Nmlp_1679 protein networkhttps://string-db.org/network/268739.Nmlp_1679DUF234 domain protein.
vapC protein networkhttps://string-db.org/network/268739.Nmlp_1682Homolog to endonuclease VapC; Toxic component of a toxin-antitoxin (TA) system. An RNase. Belongs to the PINc/VapC protein family.
Nmlp_1683 protein networkhttps://string-db.org/network/268739.Nmlp_1683Homolog to antitoxin VapB.
Nmlp_1684 protein networkhttps://string-db.org/network/268739.Nmlp_1684PadR family transcription regulator.
Nmlp_1685 protein networkhttps://string-db.org/network/268739.Nmlp_1685Uncharacterized protein.
Nmlp_1686 protein networkhttps://string-db.org/network/268739.Nmlp_1686Uncharacterized protein.
Nmlp_1687 protein networkhttps://string-db.org/network/268739.Nmlp_1687Uncharacterized protein.
Nmlp_1688 protein networkhttps://string-db.org/network/268739.Nmlp_1688Uncharacterized protein.
Nmlp_1689 protein networkhttps://string-db.org/network/268739.Nmlp_1689ISH14-type transposase ISNamo11.
Nmlp_1690 protein networkhttps://string-db.org/network/268739.Nmlp_1690SirR/DtxR family transcription regulator.
Nmlp_1691 protein networkhttps://string-db.org/network/268739.Nmlp_1691Ferritin domain protein.
sufB2 protein networkhttps://string-db.org/network/268739.Nmlp_1692SufB domain protein.
sufB1 protein networkhttps://string-db.org/network/268739.Nmlp_1693SufB domain protein.
sufC protein networkhttps://string-db.org/network/268739.Nmlp_1694Fe-S cluster assembly ATPase SufC.
polB protein networkhttps://string-db.org/network/268739.Nmlp_1695DNA-directed DNA polymerase B (intein-containing).
Nmlp_1696 protein networkhttps://string-db.org/network/268739.Nmlp_1696Uncharacterized protein.
Nmlp_1697 protein networkhttps://string-db.org/network/268739.Nmlp_1697Uncharacterized protein.
Nmlp_1698 protein networkhttps://string-db.org/network/268739.Nmlp_1698HTH domain protein.
rad50 protein networkhttps://string-db.org/network/268739.Nmlp_1699DNA double-strand break repair ATPase Rad50; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Rad50 controls the balance between DNA [...]
mre11 protein networkhttps://string-db.org/network/268739.Nmlp_1700DNA double-strand break repair protein Mre11; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Mre11 binds to DSB ends and has both d [...]
Nmlp_1701 protein networkhttps://string-db.org/network/268739.Nmlp_1701Uncharacterized protein.
Nmlp_1702 protein networkhttps://string-db.org/network/268739.Nmlp_1702NP_1176A family transcription regulator.
pan2 protein networkhttps://string-db.org/network/268739.Nmlp_1703Proteasome-activating nucleotidase; ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is esse [...]
Nmlp_1704 protein networkhttps://string-db.org/network/268739.Nmlp_1704Uncharacterized protein.
Nmlp_1705 protein networkhttps://string-db.org/network/268739.Nmlp_1705Uncharacterized protein.
Nmlp_1706 protein networkhttps://string-db.org/network/268739.Nmlp_1706DUF583 domain protein.
Nmlp_1707 protein networkhttps://string-db.org/network/268739.Nmlp_1707GTP-binding protein.
Nmlp_1710 protein networkhttps://string-db.org/network/268739.Nmlp_1710Homolog to restriction system mrr.
Nmlp_1713 protein networkhttps://string-db.org/network/268739.Nmlp_1713Probable RfbX family transport protein; Product: IS1341-type transposase NmIRS26 (nonfunctional).
Nmlp_1715 protein networkhttps://string-db.org/network/268739.Nmlp_1715Methyltranf_PUA domain-containing protein; Gene is interrupted (insert,in-frame stop) and is truncated at both termini; locus_tag: Nmlp_1714; product: ATP-dependent helicase (nonfunctional).
cna protein networkhttps://string-db.org/network/268739.Nmlp_1716tRNA/rRNA cytosine-C5-methylase; Belongs to the class I-like SAM-binding methyltransferase superfamily. RsmB/NOP family.
Nmlp_1717 protein networkhttps://string-db.org/network/268739.Nmlp_1717PAC2 family protein.
Nmlp_1718 protein networkhttps://string-db.org/network/268739.Nmlp_1718DUF88 family protein.
Nmlp_1719 protein networkhttps://string-db.org/network/268739.Nmlp_1719M20 family amidohydrolase (homolog to indole-3-acetyl-aspartate hydrolase).
rps10b protein networkhttps://string-db.org/network/268739.Nmlp_172030S ribosomal protein S10b; Involved in the binding of tRNA to the ribosomes. Belongs to the universal ribosomal protein uS10 family.
Nmlp_1721 protein networkhttps://string-db.org/network/268739.Nmlp_1721NUDIX family hydrolase.
Nmlp_1722 protein networkhttps://string-db.org/network/268739.Nmlp_1722HesB/IscA family iron-sulfur cluster assembly accessory protein.
Nmlp_1724 protein networkhttps://string-db.org/network/268739.Nmlp_1724tRNA-Val; anticodon=CAC.
Nmlp_1725 protein networkhttps://string-db.org/network/268739.Nmlp_1725ABC-type transport system permease protein.
Nmlp_1728 protein networkhttps://string-db.org/network/268739.Nmlp_1728ISH11-type transposase ISNamo4.
Nmlp_1729 protein networkhttps://string-db.org/network/268739.Nmlp_1729Uncharacterized protein.
aldH3 protein networkhttps://string-db.org/network/268739.Nmlp_1730Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
Nmlp_1733 protein networkhttps://string-db.org/network/268739.Nmlp_1733Probable DEAD/DEAH box helicase.
Nmlp_1734 protein networkhttps://string-db.org/network/268739.Nmlp_1734Gene has been targetted by a transposon; locus_tag: Nmlp_1735; product: homolog to modification methylase (nonfunctional); conceptual translation after in silico reconstruction: MSEKVTDETENSESKAP [...]
Nmlp_1736 protein networkhttps://string-db.org/network/268739.Nmlp_1736Uncharacterized protein.
Nmlp_1737 protein networkhttps://string-db.org/network/268739.Nmlp_1737DUF499 domain protein.
Nmlp_1738 protein networkhttps://string-db.org/network/268739.Nmlp_1738Homolog to phage integrase.
Nmlp_1739 protein networkhttps://string-db.org/network/268739.Nmlp_1739Uncharacterized protein.
Nmlp_1740 protein networkhttps://string-db.org/network/268739.Nmlp_1740Uncharacterized protein.
Nmlp_1741 protein networkhttps://string-db.org/network/268739.Nmlp_1741Uncharacterized protein.
cre3c protein networkhttps://string-db.org/network/268739.Nmlp_1743Creatininase domain protein.
Nmlp_1744 protein networkhttps://string-db.org/network/268739.Nmlp_1744Uncharacterized protein.
Nmlp_1745 protein networkhttps://string-db.org/network/268739.Nmlp_1745Uncharacterized protein.
Nmlp_1746 protein networkhttps://string-db.org/network/268739.Nmlp_1746Uncharacterized protein.
atoE protein networkhttps://string-db.org/network/268739.Nmlp_1747AtoE family transport protein.
Nmlp_1748 protein networkhttps://string-db.org/network/268739.Nmlp_1748Uncharacterized protein; Product: XerC/D-like integrase (nonfunctional).
Nmlp_1749 protein networkhttps://string-db.org/network/268739.Nmlp_1749Uncharacterized protein.
Nmlp_1750 protein networkhttps://string-db.org/network/268739.Nmlp_1750Uncharacterized protein.
Nmlp_1751 protein networkhttps://string-db.org/network/268739.Nmlp_1751IS1341-type transposase ISNamo23.
Nmlp_1752 protein networkhttps://string-db.org/network/268739.Nmlp_1752Lrp/AsnC family transcription regulator.
gvpO protein networkhttps://string-db.org/network/268739.Nmlp_1753Gas-vesicle operon protein GvpO.
gvpN protein networkhttps://string-db.org/network/268739.Nmlp_1754Gas-vesicle operon protein GvpN.
gvpC protein networkhttps://string-db.org/network/268739.Nmlp_1755Gas-vesicle minor protein GvpC.
gvpA protein networkhttps://string-db.org/network/268739.Nmlp_1756Gas-vesicle major structural protein GvpA; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning [...]
gvpD protein networkhttps://string-db.org/network/268739.Nmlp_1757Regulatory protein GvpD.
Nmlp_1759 protein networkhttps://string-db.org/network/268739.Nmlp_1759ISHwa16-type transposase ISNamo14.
gvpE protein networkhttps://string-db.org/network/268739.Nmlp_1760PadR family transcription activator GvpE.
gvpF protein networkhttps://string-db.org/network/268739.Nmlp_1761Gas-vesicle-associated protein GvpF.
gvpG protein networkhttps://string-db.org/network/268739.Nmlp_1762Gas-vesicle-associated protein GvpG.
gvpH protein networkhttps://string-db.org/network/268739.Nmlp_1763Gas-vesicle operon protein GvpH.
gvpI protein networkhttps://string-db.org/network/268739.Nmlp_1764Gas-vesicle operon protein GvpI.
gvpJ protein networkhttps://string-db.org/network/268739.Nmlp_1765Gas-vesicle-associated protein GvpJ; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the [...]
gvpK protein networkhttps://string-db.org/network/268739.Nmlp_1766Gas-vesicle operon protein GvpK.
gvpL protein networkhttps://string-db.org/network/268739.Nmlp_1767Gas-vesicle-associated protein GvpL.
gvpM protein networkhttps://string-db.org/network/268739.Nmlp_1768Gas-vesicle-associated protein GvpM.
Nmlp_1770 protein networkhttps://string-db.org/network/268739.Nmlp_1770Product: DUF234 domain protein (nonfunctional).
Nmlp_1771 protein networkhttps://string-db.org/network/268739.Nmlp_1771PIN domain protein.
aroQ protein networkhttps://string-db.org/network/268739.Nmlp_1772Chorismate mutase.
aroK protein networkhttps://string-db.org/network/268739.Nmlp_1773Shikimate kinase, archaeal-type.
Nmlp_1774 protein networkhttps://string-db.org/network/268739.Nmlp_1774Glyoxalase domain protein.
Nmlp_1775 protein networkhttps://string-db.org/network/268739.Nmlp_1775Homolog to archaease.
Nmlp_1776 protein networkhttps://string-db.org/network/268739.Nmlp_1776Homolog to sodium/calcium antiporter.
Nmlp_1777 protein networkhttps://string-db.org/network/268739.Nmlp_1777ABC-type transport system accessory transmembrane protein.
Nmlp_1778 protein networkhttps://string-db.org/network/268739.Nmlp_1778ABC-type transport system permease protein.
Nmlp_1780 protein networkhttps://string-db.org/network/268739.Nmlp_1780GNAT family acetyltransferase.
priS protein networkhttps://string-db.org/network/268739.Nmlp_1781DNA primase small subunit; Catalytic subunit of DNA primase, an RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. The s [...]
ginS protein networkhttps://string-db.org/network/268739.Nmlp_1782DNA replication factor GINS.
Nmlp_1783 protein networkhttps://string-db.org/network/268739.Nmlp_1783Uncharacterized protein.
cdc48b protein networkhttps://string-db.org/network/268739.Nmlp_1784AAA-type ATPase (CDC48 subfamily).
Nmlp_1785 protein networkhttps://string-db.org/network/268739.Nmlp_1785Small CPxCG-related zinc finger protein.
Tif2Bd protein networkhttps://string-db.org/network/268739.Nmlp_1786eIF-2B domain protein; Belongs to the eIF-2B alpha/beta/delta subunits family.
lhr1 protein networkhttps://string-db.org/network/268739.Nmlp_1787ATP-dependent DNA helicase.
trxA4 protein networkhttps://string-db.org/network/268739.Nmlp_1789Thioredoxin; Product: UspA domain protein (nonfunctional).
Nmlp_1790 protein networkhttps://string-db.org/network/268739.Nmlp_1790Uncharacterized protein.
ferA2 protein networkhttps://string-db.org/network/268739.Nmlp_1791Ferredoxin (2Fe-2S).
mutS5b protein networkhttps://string-db.org/network/268739.Nmlp_1792DNA mismatch repair protein MutS.
Nmlp_1793 protein networkhttps://string-db.org/network/268739.Nmlp_1793DUF814 domain protein.
Nmlp_1794 protein networkhttps://string-db.org/network/268739.Nmlp_1794DUF4013 family protein.
pelA protein networkhttps://string-db.org/network/268739.Nmlp_1795mRNA surveillance protein pelota; May function in recognizing stalled ribosomes, interact with stem-loop structures in stalled mRNA molecules, and effect endonucleolytic cleavage of the mRNA. May [...]
Nmlp_1796 protein networkhttps://string-db.org/network/268739.Nmlp_1796Homolog to ribonuclease Z.
lhr2 protein networkhttps://string-db.org/network/268739.Nmlp_1798ATP-dependent DNA helicase; Gene has a frameshift; locus_tag: Nmlp_1797; product: uncharacterized protein (nonfunctional); conceptual translation after in silico reconstruction: MVPDSPPSTLRDRLPAE [...]
thrC1 protein networkhttps://string-db.org/network/268739.Nmlp_1801Threonine synthase; Catalyzes the gamma-elimination of phosphate from L- phosphohomoserine and the beta-addition of water to produce L- threonine.
Nmlp_1802 protein networkhttps://string-db.org/network/268739.Nmlp_1802Uncharacterized protein.
Nmlp_1803 protein networkhttps://string-db.org/network/268739.Nmlp_1803Uncharacterized protein.
Nmlp_1804 protein networkhttps://string-db.org/network/268739.Nmlp_1804TrmB family transcription regulator; Product: IS1341-type transposase NmIRS69 (nonfunctional).
Nmlp_1805 protein networkhttps://string-db.org/network/268739.Nmlp_1805Alpha/beta hydrolase fold protein.
Nmlp_1806 protein networkhttps://string-db.org/network/268739.Nmlp_1806Small CPxCG-related zinc finger protein.
uvrD protein networkhttps://string-db.org/network/268739.Nmlp_1807Repair helicase UvrD.
Nmlp_1808 protein networkhttps://string-db.org/network/268739.Nmlp_1808RIO-type protein kinase domain protein.
Nmlp_1809 protein networkhttps://string-db.org/network/268739.Nmlp_1809ISH14-type transposase ISNamo8.
purF protein networkhttps://string-db.org/network/268739.Nmlp_1810Amidophosphoribosyltransferase; Catalyzes the formation of phosphoribosylamine from phosphoribosylpyrophosphate (PRPP) and glutamine.
rpl37e protein networkhttps://string-db.org/network/268739.Nmlp_181150S ribosomal protein L37e; Binds to the 23S rRNA; Belongs to the eukaryotic ribosomal protein eL37 family.
lsm protein networkhttps://string-db.org/network/268739.Nmlp_1812RNA-binding protein Lsm.
Nmlp_1813 protein networkhttps://string-db.org/network/268739.Nmlp_1813Peptidase M42 family protein.
Nmlp_1814 protein networkhttps://string-db.org/network/268739.Nmlp_1814Uncharacterized protein.
rio2 protein networkhttps://string-db.org/network/268739.Nmlp_1815RIO-type serine/threonine protein kinase Rio2.
vapB1 protein networkhttps://string-db.org/network/268739.Nmlp_1816Probable VapB/AbrB family antitoxin.
vapC1 protein networkhttps://string-db.org/network/268739.Nmlp_1817Probable ribonuclease VapC; Toxic component of a toxin-antitoxin (TA) system. An RNase. Belongs to the PINc/VapC protein family.
rpl15e protein networkhttps://string-db.org/network/268739.Nmlp_181850S ribosomal protein L15e; Belongs to the eukaryotic ribosomal protein eL15 family.
Nmlp_1819 protein networkhttps://string-db.org/network/268739.Nmlp_1819M50 family metalloprotease; Belongs to the peptidase M50B family.
Nmlp_1820 protein networkhttps://string-db.org/network/268739.Nmlp_1820Uncharacterized protein.
Nmlp_1821 protein networkhttps://string-db.org/network/268739.Nmlp_1821Uncharacterized protein.
Nmlp_1822 protein networkhttps://string-db.org/network/268739.Nmlp_1822AhpD family protein.
Nmlp_1823 protein networkhttps://string-db.org/network/268739.Nmlp_1823UPF0721 family protein.
CCQ36011.1 protein networkhttps://string-db.org/network/268739.Nmlp_1823AUncharacterized protein.
Nmlp_1824 protein networkhttps://string-db.org/network/268739.Nmlp_1824Uncharacterized protein.
bdhA1 protein networkhttps://string-db.org/network/268739.Nmlp_18253-hydroxybutyrate dehydrogenase.
Nmlp_1826 protein networkhttps://string-db.org/network/268739.Nmlp_1826Poly(3-hydroxybutyrate) depolymerase.
Nmlp_1827 protein networkhttps://string-db.org/network/268739.Nmlp_1827Uncharacterized protein.
lpdA2 protein networkhttps://string-db.org/network/268739.Nmlp_1828Dihydrolipoyl dehydrogenase.
Nmlp_1829 protein networkhttps://string-db.org/network/268739.Nmlp_1829TrmB family transcription regulator.
Nmlp_1830 protein networkhttps://string-db.org/network/268739.Nmlp_1830Uncharacterized protein.
pchB protein networkhttps://string-db.org/network/268739.Nmlp_1831PhoU/TrkA-C domain protein.
MgtE1 protein networkhttps://string-db.org/network/268739.Nmlp_1832MgtE family transport protein.
MgtE2 protein networkhttps://string-db.org/network/268739.Nmlp_1833MgtE family transport protein.
Nmlp_1834 protein networkhttps://string-db.org/network/268739.Nmlp_1834Uncharacterized protein.
mutS1a protein networkhttps://string-db.org/network/268739.Nmlp_1835DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. It is possible that it carries out the mismatch recognition step. This protein has a weak ATPase act [...]
nucS protein networkhttps://string-db.org/network/268739.Nmlp_1836Endonuclease NucS; Cleaves both 3' and 5' ssDNA extremities of branched DNA structures; Belongs to the NucS endonuclease family.
Nmlp_1837 protein networkhttps://string-db.org/network/268739.Nmlp_1837Uncharacterized protein.
Nmlp_1838 protein networkhttps://string-db.org/network/268739.Nmlp_1838SSSF family transport protein; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
tenA1 protein networkhttps://string-db.org/network/268739.Nmlp_1839Aminopyrimidine aminohydrolase.
thiN2 protein networkhttps://string-db.org/network/268739.Nmlp_1840HTH domain protein / thiamine-phosphate synthase.
Nmlp_1842 protein networkhttps://string-db.org/network/268739.Nmlp_1842Product: thioredoxin domain protein (nonfunctional).
Nmlp_1843 protein networkhttps://string-db.org/network/268739.Nmlp_1843HTH domain protein.
Nmlp_1844 protein networkhttps://string-db.org/network/268739.Nmlp_1844Uncharacterized protein.
Nmlp_1845 protein networkhttps://string-db.org/network/268739.Nmlp_1845DUF4013 family protein.
Nmlp_1846 protein networkhttps://string-db.org/network/268739.Nmlp_1846Uncharacterized protein.
Nmlp_1847 protein networkhttps://string-db.org/network/268739.Nmlp_1847ISH14-type transposase ISNamo9.
Nmlp_1848 protein networkhttps://string-db.org/network/268739.Nmlp_1848Probable oxidoreductase (short-chain dehydrogenase family).
Nmlp_1849 protein networkhttps://string-db.org/network/268739.Nmlp_1849UPF0104 family protein.
gtl7 protein networkhttps://string-db.org/network/268739.Nmlp_1850Probable glycosyltransferase, type 2.
glpA2 protein networkhttps://string-db.org/network/268739.Nmlp_1851Glycerol-3-phosphate dehydrogenase subunit A; Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family.
ferA4 protein networkhttps://string-db.org/network/268739.Nmlp_1852Ferredoxin (2Fe-2S).
Nmlp_1853 protein networkhttps://string-db.org/network/268739.Nmlp_1853IS1341-type transposase ISNamo21; Gene has been targetted by a transposon; locus_tag: Nmlp_1855; conceptual translation after in silico reconstruction: MSTDNSDDTTEHHAHEHRDVGGPGYPTPAAMRTESGREQTAYV [...]
Nmlp_1854 protein networkhttps://string-db.org/network/268739.Nmlp_1854Uncharacterized protein.
Nmlp_1856 protein networkhttps://string-db.org/network/268739.Nmlp_1856Probable oxidoreductase (homolog to saccharopine dehydrogenase).
thrS protein networkhttps://string-db.org/network/268739.Nmlp_1857threonine--tRNA ligase; Belongs to the class-II aminoacyl-tRNA synthetase family.
Nmlp_1858 protein networkhttps://string-db.org/network/268739.Nmlp_1858Uncharacterized protein.
Nmlp_1859 protein networkhttps://string-db.org/network/268739.Nmlp_1859Uncharacterized protein.
Nmlp_1860 protein networkhttps://string-db.org/network/268739.Nmlp_1860KaiC domain protein.
nadK1 protein networkhttps://string-db.org/network/268739.Nmlp_1861Probable NAD kinase (polyphosphate/ATP); Involved in the regulation of the intracellular balance of NAD and NADP, and is a key enzyme in the biosynthesis of NADP. Catalyzes specifically the phosp [...]
mptA protein networkhttps://string-db.org/network/268739.Nmlp_1862GTP cyclohydrolase MptA; Converts GTP to 7,8-dihydro-D-neopterin 2',3'-cyclic phosphate, the first intermediate in the biosynthesis of coenzyme methanopterin.
Nmlp_1863 protein networkhttps://string-db.org/network/268739.Nmlp_1863YyaL family protein.
secD protein networkhttps://string-db.org/network/268739.Nmlp_1864Protein-export membrane protein SecD; Involved in protein export.
secF protein networkhttps://string-db.org/network/268739.Nmlp_1865Protein-export membrane protein SecF; Involved in protein export.
hcp2 protein networkhttps://string-db.org/network/268739.Nmlp_1866Halocyanin.
assA protein networkhttps://string-db.org/network/268739.Nmlp_1867Probable archaetidylserine synthase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
Nmlp_1868 protein networkhttps://string-db.org/network/268739.Nmlp_1868HEAT-PBS family protein.
ppc protein networkhttps://string-db.org/network/268739.Nmlp_1869Phosphoenolpyruvate carboxylase.
Nmlp_1870 protein networkhttps://string-db.org/network/268739.Nmlp_1870Phospholipase D domain protein.
Nmlp_1871 protein networkhttps://string-db.org/network/268739.Nmlp_1871DHH/RecJ family phosphoesterase.
Nmlp_1872 protein networkhttps://string-db.org/network/268739.Nmlp_1872JAB domain protein.
ribL protein networkhttps://string-db.org/network/268739.Nmlp_1873FAD synthase; Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
gth1 protein networkhttps://string-db.org/network/268739.Nmlp_1874Probable glycosyltransferase, type 1.
gth2 protein networkhttps://string-db.org/network/268739.Nmlp_1875Probable glycosyltransferase, type 1.
Nmlp_1876 protein networkhttps://string-db.org/network/268739.Nmlp_1876Amine oxidase domain protein.
Nmlp_1877 protein networkhttps://string-db.org/network/268739.Nmlp_1877AI-2E family transport protein.
Nmlp_1878 protein networkhttps://string-db.org/network/268739.Nmlp_1878Uncharacterized protein.
Nmlp_1879 protein networkhttps://string-db.org/network/268739.Nmlp_1879Flavin-dependent pyridine nucleotide oxidoreductase.
Nmlp_1880 protein networkhttps://string-db.org/network/268739.Nmlp_1880Uncharacterized protein.
Nmlp_1881 protein networkhttps://string-db.org/network/268739.Nmlp_1881Uncharacterized protein.
Nmlp_1882 protein networkhttps://string-db.org/network/268739.Nmlp_1882Uncharacterized protein.
Nmlp_1883 protein networkhttps://string-db.org/network/268739.Nmlp_1883Uncharacterized protein.
Nmlp_1884 protein networkhttps://string-db.org/network/268739.Nmlp_1884GtrA family protein.
gtl3 protein networkhttps://string-db.org/network/268739.Nmlp_1885Probable glycosyltransferase, type 2.
Nmlp_1886 protein networkhttps://string-db.org/network/268739.Nmlp_1886DUF2298 family protein.
pcc1 protein networkhttps://string-db.org/network/268739.Nmlp_1887KEOPS complex subunit Pcc1.
rpoP protein networkhttps://string-db.org/network/268739.Nmlp_1888DNA-directed RNA polymerase subunit P; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...]
rpl43e protein networkhttps://string-db.org/network/268739.Nmlp_188950S ribosomal protein L43e.
Nmlp_1890 protein networkhttps://string-db.org/network/268739.Nmlp_1890DUF2103 family protein.
truD protein networkhttps://string-db.org/network/268739.Nmlp_1891tRNA pseudouridine(13) synthase TruD; Could be responsible for synthesis of pseudouridine from uracil-13 in transfer RNAs; Belongs to the pseudouridine synthase TruD family.
Nmlp_1892 protein networkhttps://string-db.org/network/268739.Nmlp_1892NamA family oxidoreductase.
pth protein networkhttps://string-db.org/network/268739.Nmlp_1893peptidyl-tRNA hydrolase.
gtl5 protein networkhttps://string-db.org/network/268739.Nmlp_1894Probable glycosyltransferase, type 2.
Nmlp_1895 protein networkhttps://string-db.org/network/268739.Nmlp_1895Homolog to NAD-dependent epimerase/dehydratase.
Nmlp_1896 protein networkhttps://string-db.org/network/268739.Nmlp_1896Uncharacterized protein.
Nmlp_1897 protein networkhttps://string-db.org/network/268739.Nmlp_1897Uncharacterized protein.
Nmlp_1898 protein networkhttps://string-db.org/network/268739.Nmlp_1898Uncharacterized protein.
Nmlp_1899 protein networkhttps://string-db.org/network/268739.Nmlp_1899Uncharacterized protein.
Nmlp_1900 protein networkhttps://string-db.org/network/268739.Nmlp_1900Uncharacterized protein.
Nmlp_1901 protein networkhttps://string-db.org/network/268739.Nmlp_1901Type IV pilus biogenesis complex membrane subunit.
Nmlp_1902 protein networkhttps://string-db.org/network/268739.Nmlp_1902Type IV pilus biogenesis complex ATPase subunit.
Nmlp_1903 protein networkhttps://string-db.org/network/268739.Nmlp_1903Uncharacterized protein.
Nmlp_1904 protein networkhttps://string-db.org/network/268739.Nmlp_1904Uncharacterized protein.
Nmlp_1905 protein networkhttps://string-db.org/network/268739.Nmlp_1905IS1341-type transposase ISNamo23.
Nmlp_1906 protein networkhttps://string-db.org/network/268739.Nmlp_1906Uncharacterized protein.
cat2 protein networkhttps://string-db.org/network/268739.Nmlp_1907Transport protein (probable substrate cationic amino acids).
Nmlp_1908 protein networkhttps://string-db.org/network/268739.Nmlp_1908Probable phosphodiesterase.
Nmlp_1909 protein networkhttps://string-db.org/network/268739.Nmlp_1909Uncharacterized protein.
Nmlp_1912 protein networkhttps://string-db.org/network/268739.Nmlp_1912LpxA family protein.
phnE protein networkhttps://string-db.org/network/268739.Nmlp_1913ABC-type transport system permease protein (probable substrate phosphate/phosphonate).
phnC protein networkhttps://string-db.org/network/268739.Nmlp_1914ABC-type transport system ATP-binding protein (probable substrate phosphate/phosphonate); Part of the ABC transporter complex PhnCDE involved in phosphonates import. Responsible for energy coupli [...]
phnD protein networkhttps://string-db.org/network/268739.Nmlp_1915ABC-type transport system periplasmic substrate-binding protein (probable substrate phosphate/phosphonate).
phnG protein networkhttps://string-db.org/network/268739.Nmlp_1916Alkylphosphonate cleavage complex subunit PhnG.
phnH protein networkhttps://string-db.org/network/268739.Nmlp_1917Alkylphosphonate cleavage complex subunit PhnH.
phnI protein networkhttps://string-db.org/network/268739.Nmlp_1918alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase PhnI.
phnJ protein networkhttps://string-db.org/network/268739.Nmlp_1919alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase.
phnK protein networkhttps://string-db.org/network/268739.Nmlp_1920Alkylphosphonate cleavage complex subunit PhnK.
phnL protein networkhttps://string-db.org/network/268739.Nmlp_1921Alkylphosphonate cleavage complex subunit PhnL.
phnM protein networkhttps://string-db.org/network/268739.Nmlp_1922alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase.
Nmlp_1923 protein networkhttps://string-db.org/network/268739.Nmlp_1923YfiH family protein.
Nmlp_1924 protein networkhttps://string-db.org/network/268739.Nmlp_1924HAD superfamily hydrolase.
Nmlp_1928 protein networkhttps://string-db.org/network/268739.Nmlp_1928Uncharacterized protein; Product: ISH3-type transposase NmIRS14 (nonfunctional).
Nmlp_1929 protein networkhttps://string-db.org/network/268739.Nmlp_1929Uncharacterized protein.
Nmlp_1930 protein networkhttps://string-db.org/network/268739.Nmlp_1930Probable coiled coil protein.
Nmlp_1931 protein networkhttps://string-db.org/network/268739.Nmlp_1931Uncharacterized protein.
Nmlp_1932 protein networkhttps://string-db.org/network/268739.Nmlp_1932Uncharacterized protein.
Nmlp_1933 protein networkhttps://string-db.org/network/268739.Nmlp_1933ISH9-type transposase ISNamo1.
Nmlp_1937 protein networkhttps://string-db.org/network/268739.Nmlp_1937Uncharacterized protein; Gene has a frameshift and is truncated at both termini; locus_tag: Nmlp_1936; product: ISH11-type transposase NmIRS9 (nonfunctional).
Nmlp_1938 protein networkhttps://string-db.org/network/268739.Nmlp_1938ArsR family transcription regulator.
Nmlp_1939 protein networkhttps://string-db.org/network/268739.Nmlp_1939Uncharacterized protein.
Nmlp_1940 protein networkhttps://string-db.org/network/268739.Nmlp_1940Uncharacterized protein.
apbE protein networkhttps://string-db.org/network/268739.Nmlp_1941Flavin transferase ApbE.
Nmlp_1942 protein networkhttps://string-db.org/network/268739.Nmlp_1942Glutamate/aspartate-rich protein.
trm56 protein networkhttps://string-db.org/network/268739.Nmlp_1943tRNA (cytidine(56)-2'-O)-methyltransferase; Specifically catalyzes the AdoMet-dependent 2'-O-ribose methylation of cytidine at position 56 in tRNAs; Belongs to the aTrm56 family.
Nmlp_1944 protein networkhttps://string-db.org/network/268739.Nmlp_1944GalE family epimerase/dehydratase.
Nmlp_1945 protein networkhttps://string-db.org/network/268739.Nmlp_1945BsuPI domain protein.
Nmlp_1947 protein networkhttps://string-db.org/network/268739.Nmlp_1947Uncharacterized protein.
Nmlp_1948 protein networkhttps://string-db.org/network/268739.Nmlp_1948DUF2797 family protein.
Nmlp_1949 protein networkhttps://string-db.org/network/268739.Nmlp_1949Glycine-rich protein.
aspC3 protein networkhttps://string-db.org/network/268739.Nmlp_1951Pyridoxal phosphate-dependent aminotransferase.
ribH protein networkhttps://string-db.org/network/268739.Nmlp_19526,7-dimethyl-8-ribityllumazine synthase; Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2- butanone 4-phosphate. [...]
rpl11 protein networkhttps://string-db.org/network/268739.Nmlp_195350S ribosomal protein L11; Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors; Belongs to the universal ribosomal protein uL11 family.
Nmlp_1954 protein networkhttps://string-db.org/network/268739.Nmlp_1954Uncharacterized protein.
drg protein networkhttps://string-db.org/network/268739.Nmlp_1955GTP-binding protein Drg.
Nmlp_1956 protein networkhttps://string-db.org/network/268739.Nmlp_1956DUF2391 family protein.
artA protein networkhttps://string-db.org/network/268739.Nmlp_1957Archaeosortase A.
Nmlp_1958 protein networkhttps://string-db.org/network/268739.Nmlp_1958Uncharacterized protein.
dph5 protein networkhttps://string-db.org/network/268739.Nmlp_1959Diphthine synthase; S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation fac [...]
tfbA5 protein networkhttps://string-db.org/network/268739.Nmlp_1960Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).
Nmlp_1961 protein networkhttps://string-db.org/network/268739.Nmlp_1961Small CPxCG-related zinc finger protein.
Nmlp_1962 protein networkhttps://string-db.org/network/268739.Nmlp_1962DUF420 family protein.
Nmlp_1963 protein networkhttps://string-db.org/network/268739.Nmlp_1963Sensor box histidine kinase.
Nmlp_1964 protein networkhttps://string-db.org/network/268739.Nmlp_1964Receiver/sensor/bat box HTH-10 family transcription regulator.
Nmlp_1966 protein networkhttps://string-db.org/network/268739.Nmlp_1966DUF86 family protein.
Nmlp_1967 protein networkhttps://string-db.org/network/268739.Nmlp_1967Nucleotidyltransferase domain protein.
Nmlp_1968 protein networkhttps://string-db.org/network/268739.Nmlp_1968Probable secreted glycoprotein.
Nmlp_1969 protein networkhttps://string-db.org/network/268739.Nmlp_1969tRNA-Leu; anticodon=GAG.
Nmlp_1970 protein networkhttps://string-db.org/network/268739.Nmlp_1970Uncharacterized protein.
panB protein networkhttps://string-db.org/network/268739.Nmlp_19713-methyl-2-oxobutanoate hydroxymethyltransferase; Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha- ketoisovalerate to [...]
Nmlp_1972 protein networkhttps://string-db.org/network/268739.Nmlp_1972ABC-type transport system ATP-binding protein.
Nmlp_1973 protein networkhttps://string-db.org/network/268739.Nmlp_1973ABC-type transport system permease protein.
cbs6 protein networkhttps://string-db.org/network/268739.Nmlp_1974CBS domain protein.
Nmlp_1975 protein networkhttps://string-db.org/network/268739.Nmlp_1975Homolog to small CPxCG-related zinc finger protein.
Nmlp_1976 protein networkhttps://string-db.org/network/268739.Nmlp_1976RimK family protein.
Nmlp_1977 protein networkhttps://string-db.org/network/268739.Nmlp_1977AstE domain protein.
sdhC protein networkhttps://string-db.org/network/268739.Nmlp_1978Succinate dehydrogenase subunit C; Deleted EC_number 1.3.99.1.
sdhD protein networkhttps://string-db.org/network/268739.Nmlp_1979Succinate dehydrogenase subunit D; Deleted EC_number 1.3.99.1.
sdhB protein networkhttps://string-db.org/network/268739.Nmlp_1980Succinate dehydrogenase subunit B; Deleted EC_number 1.3.99.1.
sdhA1 protein networkhttps://string-db.org/network/268739.Nmlp_1981Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1.
Nmlp_1982 protein networkhttps://string-db.org/network/268739.Nmlp_1982Cupin 2 barrel domain protein.
thiM protein networkhttps://string-db.org/network/268739.Nmlp_1983Hydroxyethylthiazole kinase; Catalyzes the phosphorylation of the hydroxyl group of 4- methyl-5-beta-hydroxyethylthiazole (THZ); Belongs to the Thz kinase family.
thiE protein networkhttps://string-db.org/network/268739.Nmlp_1984Thiamine-phosphate synthase; Condenses 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate (THZ-P) and 2-methyl-4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-PP) to form thiamine monopho [...]
Nmlp_1985 protein networkhttps://string-db.org/network/268739.Nmlp_1985Uncharacterized protein.
cysE protein networkhttps://string-db.org/network/268739.Nmlp_1988Serine O-acetyltransferase; Gene has a frameshift and is truncated at both termini; locus_tag: Nmlp_1987; product: DNA N-glycosylase (nonfunctional).
Nmlp_1989 protein networkhttps://string-db.org/network/268739.Nmlp_1989Uncharacterized protein.
Nmlp_1990 protein networkhttps://string-db.org/network/268739.Nmlp_1990Uncharacterized protein.
Nmlp_1991 protein networkhttps://string-db.org/network/268739.Nmlp_1991DUF429 family protein.
kef1 protein networkhttps://string-db.org/network/268739.Nmlp_1992Kef-type transport system.
mvaD protein networkhttps://string-db.org/network/268739.Nmlp_1993Phosphomevalonate decarboxylase.
tatA1 protein networkhttps://string-db.org/network/268739.Nmlp_1994Sec-independent protein translocase subunit TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...]
tatA2 protein networkhttps://string-db.org/network/268739.Nmlp_1995Sec-independent protein translocase subunit TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...]
Nmlp_1996 protein networkhttps://string-db.org/network/268739.Nmlp_1996Peroxiredoxin.
Nmlp_1997 protein networkhttps://string-db.org/network/268739.Nmlp_1997HD family hydrolase.
Nmlp_1998 protein networkhttps://string-db.org/network/268739.Nmlp_1998Uncharacterized protein.
Nmlp_1999 protein networkhttps://string-db.org/network/268739.Nmlp_1999Receiver box response regulator.
Nmlp_2000 protein networkhttps://string-db.org/network/268739.Nmlp_2000Uncharacterized protein.
ushA protein networkhttps://string-db.org/network/268739.Nmlp_20015'-nucleotidase family hydrolase.
Nmlp_2002 protein networkhttps://string-db.org/network/268739.Nmlp_2002UspA domain protein.
menD protein networkhttps://string-db.org/network/268739.Nmlp_20032-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylate synthase; Catalyzes the thiamine diphosphate-dependent decarboxylation of 2-oxoglutarate and the subsequent addition of the resulti [...]
menF protein networkhttps://string-db.org/network/268739.Nmlp_2004Isochorismate synthase.
Nmlp_2005 protein networkhttps://string-db.org/network/268739.Nmlp_2005UPF0058 family protein.
Nmlp_2006 protein networkhttps://string-db.org/network/268739.Nmlp_2006Uncharacterized protein.
Nmlp_2007 protein networkhttps://string-db.org/network/268739.Nmlp_2007YuiH family molybdopterin-binding domain protein.
Nmlp_2008 protein networkhttps://string-db.org/network/268739.Nmlp_2008Receiver box response regulator.
ygfD protein networkhttps://string-db.org/network/268739.Nmlp_2009YgfD family GTPase.
mmcB protein networkhttps://string-db.org/network/268739.Nmlp_2010methylmalonyl-CoA mutase subunit B (cobalamin-binding subunit).
fen1 protein networkhttps://string-db.org/network/268739.Nmlp_2011Flap endonuclease Fen1; Structure-specific nuclease with 5'-flap endonuclease and 5'- 3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-over [...]
bolA protein networkhttps://string-db.org/network/268739.Nmlp_2012BolA family protein.
fumC protein networkhttps://string-db.org/network/268739.Nmlp_2013Fumarate hydratase; Involved in the TCA cycle. Catalyzes the stereospecific interconversion of fumarate to L-malate; Belongs to the class-II fumarase/aspartase family. Fumarase subfamily.
Nmlp_2014 protein networkhttps://string-db.org/network/268739.Nmlp_2014PadR family transcription regulator.
gatE protein networkhttps://string-db.org/network/268739.Nmlp_2015glutamyl-tRNA(Gln) amidotransferase subunit E; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-t [...]
speB2 protein networkhttps://string-db.org/network/268739.Nmlp_2016Agmatinase; Belongs to the arginase family.
tef5A protein networkhttps://string-db.org/network/268739.Nmlp_2017Translation elongation factor aEF-5A; Functions by promoting the formation of the first peptide bond; Belongs to the eIF-5A family.
mch protein networkhttps://string-db.org/network/268739.Nmlp_2018Probable methenyltetrahydrofolate cyclohydrolase; Catalyzes the hydrolysis of methenyl-H(4)MPT(+) to 5-formyl- H(4)MPT.
cbs5 protein networkhttps://string-db.org/network/268739.Nmlp_2019CBS domain protein.
Nmlp_2020 protein networkhttps://string-db.org/network/268739.Nmlp_2020DMT superfamily transport protein.
Nmlp_2021 protein networkhttps://string-db.org/network/268739.Nmlp_2021Uncharacterized protein.
Nmlp_2022 protein networkhttps://string-db.org/network/268739.Nmlp_2022Uncharacterized protein.
Nmlp_2023 protein networkhttps://string-db.org/network/268739.Nmlp_2023Thioesterase domain protein.
Nmlp_2025 protein networkhttps://string-db.org/network/268739.Nmlp_2025Uncharacterized protein.
Nmlp_2026 protein networkhttps://string-db.org/network/268739.Nmlp_2026Uncharacterized protein.
Nmlp_2027 protein networkhttps://string-db.org/network/268739.Nmlp_2027Small CPxCG-related zinc finger protein.
nrdJ1 protein networkhttps://string-db.org/network/268739.Nmlp_2028Ribonucleoside-diphosphate reductase,adenosylcobalamin-dependent (intein-containing); Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from [...]
trpG3 protein networkhttps://string-db.org/network/268739.Nmlp_2029Anthranilate synthase component 2.
Nmlp_2032 protein networkhttps://string-db.org/network/268739.Nmlp_2032Gene has a frameshift and and lacks a stop codon; locus_tag: Nmlp_2031; product: CBS domain protein (nonfunctional); conceptual translation after in silico reconstruction: MNARDIMTRDVETVSPGDDVGEV [...]
Nmlp_2033 protein networkhttps://string-db.org/network/268739.Nmlp_2033Uncharacterized protein.
Nmlp_2034 protein networkhttps://string-db.org/network/268739.Nmlp_2034Uncharacterized protein.
Nmlp_2035 protein networkhttps://string-db.org/network/268739.Nmlp_2035Thioesterase domain protein.
Nmlp_2037 protein networkhttps://string-db.org/network/268739.Nmlp_2037Uncharacterized protein.
Nmlp_2038 protein networkhttps://string-db.org/network/268739.Nmlp_2038Uncharacterized protein.
trpG1 protein networkhttps://string-db.org/network/268739.Nmlp_2041Gene has frameshifts; locus_tag: Nmlp_2040; product: ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent (intein-containing) (nonfunctional); conceptual translation after in silico [...]
trpE1 protein networkhttps://string-db.org/network/268739.Nmlp_2042Anthranilate synthase component 1; Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first [...]
trpF protein networkhttps://string-db.org/network/268739.Nmlp_2043N-(5'-phosphoribosyl)anthranilate isomerase; Belongs to the TrpF family.
trpD1 protein networkhttps://string-db.org/network/268739.Nmlp_2044Anthranilate phosphoribosyltransferase; Catalyzes the transfer of the phosphoribosyl group of 5- phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'- phosphoribosyl)-anthranila [...]
Nmlp_2049 protein networkhttps://string-db.org/network/268739.Nmlp_2049HTH domain protein; Product: LpxA family protein (nonfunctional).
phoU7 protein networkhttps://string-db.org/network/268739.Nmlp_2050PhoU domain protein.
Nmlp_2051 protein networkhttps://string-db.org/network/268739.Nmlp_2051ArsR family transcription regulator; Product: ISH3-type transposase NmIRS94 (nonfunctional).
Nmlp_2052 protein networkhttps://string-db.org/network/268739.Nmlp_2052DUF318 family protein.
Nmlp_2054 protein networkhttps://string-db.org/network/268739.Nmlp_2054MATE efflux family protein.
Nmlp_2055 protein networkhttps://string-db.org/network/268739.Nmlp_2055Oxidoreductase (homolog to zinc-containing alcohol dehydrogenase).
hyuA protein networkhttps://string-db.org/network/268739.Nmlp_2056N-methylhydantoinase (ATP-hydrolyzing) A.
hyuB protein networkhttps://string-db.org/network/268739.Nmlp_2057N-methylhydantoinase (ATP-hydrolyzing) B.
Nmlp_2058 protein networkhttps://string-db.org/network/268739.Nmlp_2058Peroxiredoxin.
Nmlp_2059 protein networkhttps://string-db.org/network/268739.Nmlp_2059Uncharacterized protein.
Nmlp_2060 protein networkhttps://string-db.org/network/268739.Nmlp_2060Uncharacterized protein.
Nmlp_2061 protein networkhttps://string-db.org/network/268739.Nmlp_2061Uncharacterized protein.
Nmlp_2062 protein networkhttps://string-db.org/network/268739.Nmlp_2062Uncharacterized protein.
Nmlp_2063 protein networkhttps://string-db.org/network/268739.Nmlp_2063Luciferase-type oxidoreductase.
Nmlp_2064 protein networkhttps://string-db.org/network/268739.Nmlp_2064Uncharacterized protein.
Nmlp_2065 protein networkhttps://string-db.org/network/268739.Nmlp_2065Uncharacterized protein.
Nmlp_2066 protein networkhttps://string-db.org/network/268739.Nmlp_2066Uncharacterized protein.
Nmlp_2067 protein networkhttps://string-db.org/network/268739.Nmlp_2067Lrp/AsnC family transcription regulator.
Nmlp_2068 protein networkhttps://string-db.org/network/268739.Nmlp_2068Uncharacterized protein.
Nmlp_2069 protein networkhttps://string-db.org/network/268739.Nmlp_2069FAD dependent oxidoreductase.
mce protein networkhttps://string-db.org/network/268739.Nmlp_2070methylmalonyl-CoA epimerase.
mmcA2 protein networkhttps://string-db.org/network/268739.Nmlp_2071methylmalonyl-CoA mutase subunit A.
pcrB protein networkhttps://string-db.org/network/268739.Nmlp_2072(S)-3-O-geranylgeranylglyceryl phosphate synthase 1; Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glyce [...]
topA protein networkhttps://string-db.org/network/268739.Nmlp_2073DNA topoisomerase 1; Releases the supercoiling and torsional tension of DNA, which is introduced during the DNA replication and transcription, by transiently cleaving and rejoining one strand of [...]
gatB protein networkhttps://string-db.org/network/268739.Nmlp_2074aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu [...]
Nmlp_2076 protein networkhttps://string-db.org/network/268739.Nmlp_2076Beta-lactamase domain protein.
pepB3 protein networkhttps://string-db.org/network/268739.Nmlp_2077Aminopeptidase (homolog to leucyl aminopeptidase.
cbs3 protein networkhttps://string-db.org/network/268739.Nmlp_2078CBS domain protein.
Nmlp_2079 protein networkhttps://string-db.org/network/268739.Nmlp_2079HTH domain protein.
nirA2 protein networkhttps://string-db.org/network/268739.Nmlp_2080Probable sulfite/nitrite reductase (ferredoxin).
Nmlp_2081 protein networkhttps://string-db.org/network/268739.Nmlp_2081Uncharacterized protein.
Nmlp_2082 protein networkhttps://string-db.org/network/268739.Nmlp_2082Uncharacterized protein.
Nmlp_2083 protein networkhttps://string-db.org/network/268739.Nmlp_2083Uncharacterized protein.
mmsA protein networkhttps://string-db.org/network/268739.Nmlp_2084Methylmalonate-semialdehyde dehydrogenase.
htr40 protein networkhttps://string-db.org/network/268739.Nmlp_2085Transducer protein Htr40.
Nmlp_2086 protein networkhttps://string-db.org/network/268739.Nmlp_2086Probable S-adenosylmethionine-dependent methyltransferase.
Nmlp_2087 protein networkhttps://string-db.org/network/268739.Nmlp_2087Polyamine aminopropyltransferase.
cbs12 protein networkhttps://string-db.org/network/268739.Nmlp_2088DUF21/CBS domain protein.
Nmlp_2089 protein networkhttps://string-db.org/network/268739.Nmlp_2089SCO1/SenC/PrrC family protein.
trxA6 protein networkhttps://string-db.org/network/268739.Nmlp_2090Thioredoxin.
Nmlp_2091 protein networkhttps://string-db.org/network/268739.Nmlp_2091Homolog to cytochrome c-type biogenesis protein CcdA.
cat3 protein networkhttps://string-db.org/network/268739.Nmlp_2092Transport protein (probable substrate cationic amino acids).
Nmlp_2093 protein networkhttps://string-db.org/network/268739.Nmlp_2093UspA domain protein.
map protein networkhttps://string-db.org/network/268739.Nmlp_2094Methionine aminopeptidase; Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharg [...]
Nmlp_2095 protein networkhttps://string-db.org/network/268739.Nmlp_2095DUF63 family protein.
udp2 protein networkhttps://string-db.org/network/268739.Nmlp_2096Uridine phosphorylase.
pchA1 protein networkhttps://string-db.org/network/268739.Nmlp_2097Ion channel pore / TrkA domain protein.
Nmlp_2098 protein networkhttps://string-db.org/network/268739.Nmlp_2098TrkA-C domain protein.
Nmlp_2099 protein networkhttps://string-db.org/network/268739.Nmlp_2099TrkA-C domain protein.
Nmlp_2100 protein networkhttps://string-db.org/network/268739.Nmlp_2100Uncharacterized protein.
ddh protein networkhttps://string-db.org/network/268739.Nmlp_2102D-2-hydroxyacid dehydrogenase (NADP); Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
apt1 protein networkhttps://string-db.org/network/268739.Nmlp_2103HGPRTase-like protein; May catalyze a purine salvage reaction, the substrate is unknown.
Nmlp_2104 protein networkhttps://string-db.org/network/268739.Nmlp_2104Uncharacterized protein.
Nmlp_2105 protein networkhttps://string-db.org/network/268739.Nmlp_2105UspA domain protein.
Nmlp_2106 protein networkhttps://string-db.org/network/268739.Nmlp_2106UspA domain protein.
Nmlp_2107 protein networkhttps://string-db.org/network/268739.Nmlp_2107GNAT family acetyltransferase.
Nmlp_2108 protein networkhttps://string-db.org/network/268739.Nmlp_2108UspA domain protein.
Nmlp_2109 protein networkhttps://string-db.org/network/268739.Nmlp_2109Uncharacterized protein.
pyrC protein networkhttps://string-db.org/network/268739.Nmlp_2110Dihydroorotase; Catalyzes the reversible cyclization of carbamoyl aspartate to dihydroorotate; Belongs to the metallo-dependent hydrolases superfamily. DHOase family. Class I DHOase subfamily.
Nmlp_2111 protein networkhttps://string-db.org/network/268739.Nmlp_2111Peptidase M23 family protein.
Nmlp_2112 protein networkhttps://string-db.org/network/268739.Nmlp_2112Probable 16S rRNA maturation protein; Probable pre-rRNA processing protein involved in ribosome biogenesis; Belongs to the TSR3 family.
Nmlp_2113 protein networkhttps://string-db.org/network/268739.Nmlp_2113DUF1486 family protein.
serS protein networkhttps://string-db.org/network/268739.Nmlp_2114serine--tRNA ligase; Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L- seryl-tRNA(Sec), which will be further co [...]
Nmlp_2115 protein networkhttps://string-db.org/network/268739.Nmlp_2115Beta-lactamase domain protein.
arsA3 protein networkhttps://string-db.org/network/268739.Nmlp_2116ArsA family ATPase.
Nmlp_2117 protein networkhttps://string-db.org/network/268739.Nmlp_2117Uncharacterized protein.
Nmlp_2118 protein networkhttps://string-db.org/network/268739.Nmlp_2118CobW domain protein.
Nmlp_2121 protein networkhttps://string-db.org/network/268739.Nmlp_2121Product: uncharacterized protein (nonfunctional).
Nmlp_2122 protein networkhttps://string-db.org/network/268739.Nmlp_2122Uncharacterized protein.
Nmlp_2125 protein networkhttps://string-db.org/network/268739.Nmlp_2125Uncharacterized protein.
Nmlp_2126 protein networkhttps://string-db.org/network/268739.Nmlp_2126Uncharacterized protein.
cstA protein networkhttps://string-db.org/network/268739.Nmlp_2127Carbon starvation protein CstA.
Nmlp_2128 protein networkhttps://string-db.org/network/268739.Nmlp_2128DUF83 domain protein.
yrdC protein networkhttps://string-db.org/network/268739.Nmlp_2129threonylcarbamoyl-AMP synthase YrdC.
Nmlp_2130 protein networkhttps://string-db.org/network/268739.Nmlp_2130Peroxiredoxin domain protein.
grx2 protein networkhttps://string-db.org/network/268739.Nmlp_2131Glutaredoxin.
cbs9 protein networkhttps://string-db.org/network/268739.Nmlp_2132DUF21/CBS domain protein.
Nmlp_2133 protein networkhttps://string-db.org/network/268739.Nmlp_2133Transport protein (probable substrate phosphate/sulfate).
Nmlp_2134 protein networkhttps://string-db.org/network/268739.Nmlp_2134IMPACT family protein.
upp protein networkhttps://string-db.org/network/268739.Nmlp_2135Uracil phosphoribosyltransferase; Catalyzes the conversion of uracil and 5-phospho-alpha-D- ribose 1-diphosphate (PRPP) to UMP and diphosphate.
Nmlp_2136 protein networkhttps://string-db.org/network/268739.Nmlp_2136Uncharacterized protein.
Nmlp_2137 protein networkhttps://string-db.org/network/268739.Nmlp_2137ACT domain protein.
Nmlp_2138 protein networkhttps://string-db.org/network/268739.Nmlp_2138PaaI family protein.
mobB protein networkhttps://string-db.org/network/268739.Nmlp_2139Molybdopterin-guanine dinucleotide biosynthesis adapter protein MobB.
maoC3 protein networkhttps://string-db.org/network/268739.Nmlp_2140MaoC domain protein.
Nmlp_2141 protein networkhttps://string-db.org/network/268739.Nmlp_2141Uncharacterized protein.
Nmlp_2142 protein networkhttps://string-db.org/network/268739.Nmlp_2142Uncharacterized protein.
Nmlp_2143 protein networkhttps://string-db.org/network/268739.Nmlp_2143Uncharacterized protein.
Nmlp_2144 protein networkhttps://string-db.org/network/268739.Nmlp_2144Uncharacterized protein.
Nmlp_2145 protein networkhttps://string-db.org/network/268739.Nmlp_2145PRC domain protein.
nob1 protein networkhttps://string-db.org/network/268739.Nmlp_2146rRNA maturation endonuclease Nob1.
Nmlp_2147 protein networkhttps://string-db.org/network/268739.Nmlp_2147Abi/CAAX domain protein.
pgi protein networkhttps://string-db.org/network/268739.Nmlp_2148Glucose-6-phosphate isomerase; Belongs to the GPI family.
Nmlp_2149 protein networkhttps://string-db.org/network/268739.Nmlp_2149Uncharacterized protein.
Nmlp_2150 protein networkhttps://string-db.org/network/268739.Nmlp_2150Uncharacterized protein.
rps15 protein networkhttps://string-db.org/network/268739.Nmlp_215130S ribosomal protein S15.
recJ2 protein networkhttps://string-db.org/network/268739.Nmlp_2152Probable replication complex protein RecJ2.
Nmlp_2153 protein networkhttps://string-db.org/network/268739.Nmlp_2153Uncharacterized protein.
rps1e protein networkhttps://string-db.org/network/268739.Nmlp_215430S ribosomal protein S1e; Belongs to the eukaryotic ribosomal protein eS1 family.
tmk protein networkhttps://string-db.org/network/268739.Nmlp_2155Thymidylate kinase.
Nmlp_2156 protein networkhttps://string-db.org/network/268739.Nmlp_2156Lrp/AsnC family transcription regulator.
trkA2 protein networkhttps://string-db.org/network/268739.Nmlp_2157TrkA domain protein.
Nmlp_2158 protein networkhttps://string-db.org/network/268739.Nmlp_2158Lrp/AsnC family transcription regulator.
cspA3 protein networkhttps://string-db.org/network/268739.Nmlp_2160Cold shock protein.
tfbA1 protein networkhttps://string-db.org/network/268739.Nmlp_2161Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).
gabD protein networkhttps://string-db.org/network/268739.Nmlp_2162Succinate-semialdehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
Nmlp_2163 protein networkhttps://string-db.org/network/268739.Nmlp_2163Lrp/AsnC family transcription regulator.
carA protein networkhttps://string-db.org/network/268739.Nmlp_2164Carbamoyl-phosphate synthase (glutamine-hydrolyzing) small subunit; Belongs to the CarA family.
sopI protein networkhttps://string-db.org/network/268739.Nmlp_2165Sensory rhodopsin I.
htr1S protein networkhttps://string-db.org/network/268739.Nmlp_2166Sensory rhodopsin I transducer signalling region.
Nmlp_2167 protein networkhttps://string-db.org/network/268739.Nmlp_2167Integrase family protein.
Nmlp_2168 protein networkhttps://string-db.org/network/268739.Nmlp_2168Uncharacterized protein.
Nmlp_2169 protein networkhttps://string-db.org/network/268739.Nmlp_2169Uncharacterized protein.
Nmlp_2170 protein networkhttps://string-db.org/network/268739.Nmlp_2170Uncharacterized protein.
Nmlp_2171 protein networkhttps://string-db.org/network/268739.Nmlp_2171Uncharacterized protein.
Nmlp_2172 protein networkhttps://string-db.org/network/268739.Nmlp_2172Uncharacterized protein.
Nmlp_2173 protein networkhttps://string-db.org/network/268739.Nmlp_2173Uncharacterized protein.
Nmlp_2174 protein networkhttps://string-db.org/network/268739.Nmlp_2174Uncharacterized protein.
Nmlp_2175 protein networkhttps://string-db.org/network/268739.Nmlp_2175ISHwa16-type transposase ISNamo16.
Nmlp_2178 protein networkhttps://string-db.org/network/268739.Nmlp_2178Site-specific DNA-methyltransferase (cytosine-specific).
Nmlp_2180 protein networkhttps://string-db.org/network/268739.Nmlp_2180Site-specific DNA-methyltransferase (Cytosine-specific); Gene has an in-frame stop codon; locus_tag: Nmlp_2179; product: ISH14-type transposase ISNamo8 (nonfunctional); conceptual translation aft [...]
Nmlp_2181 protein networkhttps://string-db.org/network/268739.Nmlp_2181Uncharacterized protein.
Nmlp_2182 protein networkhttps://string-db.org/network/268739.Nmlp_2182Uncharacterized protein.
Nmlp_2184 protein networkhttps://string-db.org/network/268739.Nmlp_2184Uncharacterized protein.
Nmlp_2185 protein networkhttps://string-db.org/network/268739.Nmlp_2185Uncharacterized protein.
Nmlp_2186 protein networkhttps://string-db.org/network/268739.Nmlp_2186PLD domain protein.
Nmlp_2187 protein networkhttps://string-db.org/network/268739.Nmlp_2187Uncharacterized protein.
Nmlp_2188 protein networkhttps://string-db.org/network/268739.Nmlp_2188Helicase domain protein.
Nmlp_2189 protein networkhttps://string-db.org/network/268739.Nmlp_2189Uncharacterized protein.
Nmlp_2191 protein networkhttps://string-db.org/network/268739.Nmlp_2191DUF192 family protein.
Nmlp_2192 protein networkhttps://string-db.org/network/268739.Nmlp_2192ABC-type transport system ATP-binding/permease protein.
Nmlp_2193 protein networkhttps://string-db.org/network/268739.Nmlp_2193ATP-grasp fold protein.
Nmlp_2194 protein networkhttps://string-db.org/network/268739.Nmlp_2194Uncharacterized protein.
Nmlp_2195 protein networkhttps://string-db.org/network/268739.Nmlp_2195Uncharacterized protein.
nolA2 protein networkhttps://string-db.org/network/268739.Nmlp_2196arNOG08307 family NADH-binding domain protein.
Nmlp_2197 protein networkhttps://string-db.org/network/268739.Nmlp_2197Histidine kinase.
Nmlp_2198 protein networkhttps://string-db.org/network/268739.Nmlp_2198DUF418 domain protein.
trkA3 protein networkhttps://string-db.org/network/268739.Nmlp_2199TrkA domain protein.
cat4 protein networkhttps://string-db.org/network/268739.Nmlp_2200Transport protein (probable substrate cationic amino acids).
fxsA protein networkhttps://string-db.org/network/268739.Nmlp_2201FxsA domain protein.
gpmI protein networkhttps://string-db.org/network/268739.Nmlp_2202Phosphoglycerate mutase,2,3-biphosphateglycerate-independent type; Catalyzes the interconversion of 2-phosphoglycerate and 3- phosphoglycerate; Belongs to the BPG-independent phosphoglycerate mut [...]
Nmlp_2203 protein networkhttps://string-db.org/network/268739.Nmlp_2203Alpha/beta hydrolase fold protein.
zim protein networkhttps://string-db.org/network/268739.Nmlp_2205CTAG modification methylase.
Nmlp_2206 protein networkhttps://string-db.org/network/268739.Nmlp_2206Uncharacterized protein; Product: IS200-type transposase NmIRS33 (nonfunctional).
fadA2 protein networkhttps://string-db.org/network/268739.Nmlp_2207enoyl-CoA hydratase; Belongs to the enoyl-CoA hydratase/isomerase family.
nadE protein networkhttps://string-db.org/network/268739.Nmlp_2208NAD synthase, ammonia-dependent; Catalyzes the ATP-dependent amidation of deamido-NAD to form NAD. Uses ammonia as a nitrogen source.
serA3 protein networkhttps://string-db.org/network/268739.Nmlp_2209Probable D-2-hydroxyacid dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
Nmlp_2210 protein networkhttps://string-db.org/network/268739.Nmlp_2210UPF0047 family protein.
arfC protein networkhttps://string-db.org/network/268739.Nmlp_22122,5-diamino-6-(Ribosylamino)-4(3H)-pyrimidinone 5'-phosphate reductase; Gene has a frameshift and is truncated at the N-terminus; locus_tag: Nmlp_2211; product: poly(3-hydroxybutyrate) depolymera [...]
Nmlp_2213 protein networkhttps://string-db.org/network/268739.Nmlp_2213tRNA (cytidine/uridine-2'-O-)-methyltransferase.
Nmlp_2215 protein networkhttps://string-db.org/network/268739.Nmlp_2215Uncharacterized protein.
Nmlp_2217 protein networkhttps://string-db.org/network/268739.Nmlp_2217Alpha/beta hydrolase fold protein.
folP2 protein networkhttps://string-db.org/network/268739.Nmlp_2218Dihydropteroate synthase.
mptE protein networkhttps://string-db.org/network/268739.Nmlp_22196-hydroxymethyl-7,8-dihydropterin pyrophosphokinase MptE; Catalyzes the transfer of diphosphate from ATP to 6- hydroxymethyl-7,8-dihydropterin (6-HMD), leading to 6-hydroxymethyl- 7,8-dihydropter [...]
Nmlp_2220 protein networkhttps://string-db.org/network/268739.Nmlp_2220Probable S-adenosylmethionine-dependent methyltransferase.
trkA4 protein networkhttps://string-db.org/network/268739.Nmlp_2221TrkA domain protein.
Nmlp_2222 protein networkhttps://string-db.org/network/268739.Nmlp_2222Uncharacterized protein.
Nmlp_2223 protein networkhttps://string-db.org/network/268739.Nmlp_2223PDCD5 family DNA-binding protein; Belongs to the PDCD5 family.
serA2 protein networkhttps://string-db.org/network/268739.Nmlp_2224Probable D-2-hydroxyacid dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
Nmlp_2225 protein networkhttps://string-db.org/network/268739.Nmlp_2225UspA domain protein.
Nmlp_2226 protein networkhttps://string-db.org/network/268739.Nmlp_2226Major facilitator superfamily transport protein.
hisD protein networkhttps://string-db.org/network/268739.Nmlp_2227Histidinol dehydrogenase; Catalyzes the sequential NAD-dependent oxidations of L- histidinol to L-histidinaldehyde and then to L-histidine.
sirR protein networkhttps://string-db.org/network/268739.Nmlp_2228SirR/DtxR family transcription regulator SirR.
Nmlp_2229 protein networkhttps://string-db.org/network/268739.Nmlp_2229MTH865 family protein.
Nmlp_2230 protein networkhttps://string-db.org/network/268739.Nmlp_2230Uncharacterized protein.
Nmlp_2231 protein networkhttps://string-db.org/network/268739.Nmlp_2231Uncharacterized protein.
Nmlp_2232 protein networkhttps://string-db.org/network/268739.Nmlp_2232DUF2062 family protein.
Nmlp_2233 protein networkhttps://string-db.org/network/268739.Nmlp_2233Uncharacterized protein.
Nmlp_2234 protein networkhttps://string-db.org/network/268739.Nmlp_2234Sensor box histidine kinase.
Nmlp_2235 protein networkhttps://string-db.org/network/268739.Nmlp_2235Beta-lactamase domain protein.
Nmlp_2236 protein networkhttps://string-db.org/network/268739.Nmlp_2236Major facilitator superfamily transport protein.
Nmlp_2237 protein networkhttps://string-db.org/network/268739.Nmlp_2237Uncharacterized protein.
Nmlp_2238 protein networkhttps://string-db.org/network/268739.Nmlp_2238Lrp/AsnC family transcription regulator.
aspC1 protein networkhttps://string-db.org/network/268739.Nmlp_2239Pyridoxal phosphate-dependent aminotransferase.
Nmlp_2240 protein networkhttps://string-db.org/network/268739.Nmlp_2240Type IV pilus biogenesis complex ATPase subunit.
Nmlp_2241 protein networkhttps://string-db.org/network/268739.Nmlp_2241Type IV pilus biogenesis complex membrane subunit.
Nmlp_2242 protein networkhttps://string-db.org/network/268739.Nmlp_2242Uncharacterized protein.
Nmlp_2243 protein networkhttps://string-db.org/network/268739.Nmlp_2243Uncharacterized protein.
Nmlp_2244 protein networkhttps://string-db.org/network/268739.Nmlp_2244Uncharacterized protein.
Nmlp_2245 protein networkhttps://string-db.org/network/268739.Nmlp_2245Probable secreted glycoprotein.
Nmlp_2246 protein networkhttps://string-db.org/network/268739.Nmlp_2246Probable secreted glycoprotein.
Nmlp_2247 protein networkhttps://string-db.org/network/268739.Nmlp_2247Probable secreted glycoprotein.
Nmlp_2249 protein networkhttps://string-db.org/network/268739.Nmlp_2249Uncharacterized protein.
Nmlp_2250 protein networkhttps://string-db.org/network/268739.Nmlp_2250Uncharacterized protein.
Nmlp_2251 protein networkhttps://string-db.org/network/268739.Nmlp_2251UspA domain protein.
Nmlp_2252 protein networkhttps://string-db.org/network/268739.Nmlp_2252GNAT family acetyltransferase.
Nmlp_2253 protein networkhttps://string-db.org/network/268739.Nmlp_2253Probable S-adenosylmethionine-dependent methyltransferase.
Nmlp_2254 protein networkhttps://string-db.org/network/268739.Nmlp_2254DUF3054 family protein.
Nmlp_2255 protein networkhttps://string-db.org/network/268739.Nmlp_2255Major facilitator superfamily transport protein.
aroC protein networkhttps://string-db.org/network/268739.Nmlp_2256Chorismate synthase; Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch poin [...]
guaB2 protein networkhttps://string-db.org/network/268739.Nmlp_2257Inosine-5'-monophosphate dehydrogenase.
aroA protein networkhttps://string-db.org/network/268739.Nmlp_22583-phosphoshikimate 1-carboxyvinyltransferase; Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl [...]
Nmlp_2259 protein networkhttps://string-db.org/network/268739.Nmlp_2259Peptidase M24 family protein (homolog to Xaa-Pro dipeptidase).
tyrA protein networkhttps://string-db.org/network/268739.Nmlp_2260Prephenate dehydrogenase.
Nmlp_2261 protein networkhttps://string-db.org/network/268739.Nmlp_2261Probable S-adenosylmethionine-dependent methyltransferase.
Nmlp_2262 protein networkhttps://string-db.org/network/268739.Nmlp_2262Uncharacterized protein.
Nmlp_2263 protein networkhttps://string-db.org/network/268739.Nmlp_2263CopG domain protein.
Nmlp_2264 protein networkhttps://string-db.org/network/268739.Nmlp_2264Uncharacterized protein.
aglJ protein networkhttps://string-db.org/network/268739.Nmlp_2265Dolichyl-phosphate hexosyltransferase AglJ.
coaD protein networkhttps://string-db.org/network/268739.Nmlp_2266Phosphopantetheine adenylyltransferase.
Nmlp_2267 protein networkhttps://string-db.org/network/268739.Nmlp_2267TrmB family transcription regulator.
Nmlp_2268 protein networkhttps://string-db.org/network/268739.Nmlp_2268RND superfamily permease.
Nmlp_2269 protein networkhttps://string-db.org/network/268739.Nmlp_2269Uncharacterized protein.
Nmlp_2270 protein networkhttps://string-db.org/network/268739.Nmlp_2270TetR family transcription regulator.
gshA protein networkhttps://string-db.org/network/268739.Nmlp_2271Glutamate--cysteine ligase; Catalyzes the synthesis of gamma-glutamylcysteine (gamma-GC), the main low-molecular-weight thiol compound instead of glutathione in halophilic archaea; Belongs to the [...]
fib protein networkhttps://string-db.org/network/268739.Nmlp_2273Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase; Involved in pre-rRNA and tRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylatio [...]
nop5 protein networkhttps://string-db.org/network/268739.Nmlp_2274rRNA/tRNA 2'-O-methyltransferase complex protein Nop5.
Nmlp_2275 protein networkhttps://string-db.org/network/268739.Nmlp_2275Homolog to autoinducer-2-degrading protein lsrG.
acd2 protein networkhttps://string-db.org/network/268739.Nmlp_2276acyl-CoA dehydrogenase.
Nmlp_2277 protein networkhttps://string-db.org/network/268739.Nmlp_2277Receiver/sensor box histidine kinase.
Nmlp_2278 protein networkhttps://string-db.org/network/268739.Nmlp_2278Receiver box histidine kinase.
Nmlp_2279 protein networkhttps://string-db.org/network/268739.Nmlp_2279Receiver box response regulator.
mcm protein networkhttps://string-db.org/network/268739.Nmlp_2280ATP-dependent DNA helicase MCM (intein-containing).
Nmlp_2281 protein networkhttps://string-db.org/network/268739.Nmlp_2281Uncharacterized protein.
Nmlp_2282 protein networkhttps://string-db.org/network/268739.Nmlp_2282Uncharacterized protein.
Nmlp_2283 protein networkhttps://string-db.org/network/268739.Nmlp_2283Uncharacterized protein.
Nmlp_2284 protein networkhttps://string-db.org/network/268739.Nmlp_2284Uncharacterized protein.
Nmlp_2288 protein networkhttps://string-db.org/network/268739.Nmlp_2288Probable secreted glycoprotein.
Nmlp_2289 protein networkhttps://string-db.org/network/268739.Nmlp_2289Uncharacterized protein.
Nmlp_2290 protein networkhttps://string-db.org/network/268739.Nmlp_2290CopD domain protein.
lpdA1 protein networkhttps://string-db.org/network/268739.Nmlp_2291Dihydrolipoyl dehydrogenase.
aspC5 protein networkhttps://string-db.org/network/268739.Nmlp_2292Pyridoxal phosphate-dependent aminotransferase.
Nmlp_2293 protein networkhttps://string-db.org/network/268739.Nmlp_2293Small CPxCG-related zinc finger protein.
Nmlp_2294 protein networkhttps://string-db.org/network/268739.Nmlp_2294Homolog to carboxylate-amine ligase.
guaAa2 protein networkhttps://string-db.org/network/268739.Nmlp_2295Glutamine amidotransferase (homolog to GMP synthase subunit A).
Nmlp_2296 protein networkhttps://string-db.org/network/268739.Nmlp_2296Homolog to translation elongation factor aEF-1 alpha subunit.
Nmlp_2297 protein networkhttps://string-db.org/network/268739.Nmlp_2297Phosphoglycolate phosphatase; Catalyzes the dephosphorylation of 2-phosphoglycolate.
Nmlp_2298 protein networkhttps://string-db.org/network/268739.Nmlp_2298Uncharacterized protein.
tif1A2 protein networkhttps://string-db.org/network/268739.Nmlp_2300Translation initiation factor aIF-1A; Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-t [...]
Nmlp_2301 protein networkhttps://string-db.org/network/268739.Nmlp_2301GTP-binding protein.
cyc1 protein networkhttps://string-db.org/network/268739.Nmlp_2302Cytochrome P450.
oxdhA2 protein networkhttps://string-db.org/network/268739.Nmlp_2303Probable 2-oxoacid dehydrogenase E1 component alpha subunit.
Nmlp_2304 protein networkhttps://string-db.org/network/268739.Nmlp_2304Uncharacterized protein.
elp3 protein networkhttps://string-db.org/network/268739.Nmlp_2305Homolog to elongator complex protein ELP3.
Nmlp_2306 protein networkhttps://string-db.org/network/268739.Nmlp_2306DHH/RecJ family phosphoesterase.
Nmlp_2307 protein networkhttps://string-db.org/network/268739.Nmlp_2307Homolog to NAD(P)H dehydrogenase (quinone).
Nmlp_2308 protein networkhttps://string-db.org/network/268739.Nmlp_2308GalE family epimerase/dehydratase.
mutY protein networkhttps://string-db.org/network/268739.Nmlp_2309A/G-specific adenine glycosylase.
tenA2 protein networkhttps://string-db.org/network/268739.Nmlp_2310Aminopyrimidine aminohydrolase.
Nmlp_2311 protein networkhttps://string-db.org/network/268739.Nmlp_2311Gdt1 family protein.
Nmlp_2312 protein networkhttps://string-db.org/network/268739.Nmlp_2312Uncharacterized protein.
Nmlp_2313 protein networkhttps://string-db.org/network/268739.Nmlp_2313ArsR family transcription regulator.
nosL3 protein networkhttps://string-db.org/network/268739.Nmlp_2314NosL family protein.
nosY2 protein networkhttps://string-db.org/network/268739.Nmlp_2315ABC-type transport system permease protein (probable substrate copper).
nosF2 protein networkhttps://string-db.org/network/268739.Nmlp_2316ABC-type transport system ATP-binding protein (probable substrate copper).
nosD2 protein networkhttps://string-db.org/network/268739.Nmlp_2317ABC-type transport system periplasmic substrate-binding protein (probable substrate copper).
nosY1 protein networkhttps://string-db.org/network/268739.Nmlp_2318ABC-type transport system permease protein (probable substrate copper).
nosF1 protein networkhttps://string-db.org/network/268739.Nmlp_2319ABC-type transport system ATP-binding protein (probable substrate copper).
nosD1 protein networkhttps://string-db.org/network/268739.Nmlp_2320ABC-type transport system periplasmic substrate-binding protein (probable substrate copper).
Nmlp_2321 protein networkhttps://string-db.org/network/268739.Nmlp_2321TRAM domain protein.
Nmlp_2322 protein networkhttps://string-db.org/network/268739.Nmlp_2322Transport protein (probable substrate phosphate/sulfate).
Nmlp_2323 protein networkhttps://string-db.org/network/268739.Nmlp_2323Glutamate/valine-rich protein.
Nmlp_2324 protein networkhttps://string-db.org/network/268739.Nmlp_2324UspA domain protein.
Nmlp_2325 protein networkhttps://string-db.org/network/268739.Nmlp_2325Metallophosphoesterase domain protein.
psd protein networkhttps://string-db.org/network/268739.Nmlp_2326Probable archaetidylserine decarboxylase.
Nmlp_2327 protein networkhttps://string-db.org/network/268739.Nmlp_2327Uncharacterized protein.
Nmlp_2328 protein networkhttps://string-db.org/network/268739.Nmlp_2328Uncharacterized protein.
Nmlp_2329 protein networkhttps://string-db.org/network/268739.Nmlp_2329Small CPxCG-related zinc finger protein.
cdc48c protein networkhttps://string-db.org/network/268739.Nmlp_2330AAA-type ATPase (CDC48 subfamily).
Nmlp_2331 protein networkhttps://string-db.org/network/268739.Nmlp_2331Sensor box histidine kinase.
Nmlp_2332 protein networkhttps://string-db.org/network/268739.Nmlp_2332Peptidase M20 family protein (homolog to succinyl-diaminopimelate desuccinylase).
trxA2 protein networkhttps://string-db.org/network/268739.Nmlp_2333Thioredoxin.
Nmlp_2334 protein networkhttps://string-db.org/network/268739.Nmlp_2334FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase).
Nmlp_2335 protein networkhttps://string-db.org/network/268739.Nmlp_2335Probable oxidoreductase (aldo-keto reductase family protein).
Nmlp_2336 protein networkhttps://string-db.org/network/268739.Nmlp_2336Uncharacterized protein.
Nmlp_2337 protein networkhttps://string-db.org/network/268739.Nmlp_2337Peptidase M42 family protein.
nadK2 protein networkhttps://string-db.org/network/268739.Nmlp_2338Probable NAD kinase (polyphosphate/ATP).
Nmlp_2339 protein networkhttps://string-db.org/network/268739.Nmlp_2339Receiver/sensor box histidine kinase.
Nmlp_2340 protein networkhttps://string-db.org/network/268739.Nmlp_2340Uncharacterized protein.
uppS1 protein networkhttps://string-db.org/network/268739.Nmlp_2341Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific); Catalyzes the sequential condensation of isopentenyl diphosphate (IPP) with geranylgeranyl diphosphate (G [...]
Nmlp_2342 protein networkhttps://string-db.org/network/268739.Nmlp_2342UPF0104 family protein.
uppS2 protein networkhttps://string-db.org/network/268739.Nmlp_2343Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific).
Nmlp_2344 protein networkhttps://string-db.org/network/268739.Nmlp_2344DUF92 family protein.
Nmlp_2345 protein networkhttps://string-db.org/network/268739.Nmlp_2345GNAT family acetyltransferase.
dnaG protein networkhttps://string-db.org/network/268739.Nmlp_2346DNA primase DnaG; RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication.
pspA1 protein networkhttps://string-db.org/network/268739.Nmlp_2347PspA domain protein.
Nmlp_2348 protein networkhttps://string-db.org/network/268739.Nmlp_2348Uncharacterized protein.
rpl42e protein networkhttps://string-db.org/network/268739.Nmlp_234950S ribosomal protein L42e; Binds to the 23S rRNA.
rps27e protein networkhttps://string-db.org/network/268739.Nmlp_235030S ribosomal protein S27e.
tif2a protein networkhttps://string-db.org/network/268739.Nmlp_2351Translation initiation factor aIF-2 alpha subunit.
nop10 protein networkhttps://string-db.org/network/268739.Nmlp_2352tRNA/rRNA pseudouridine synthase complex protein Nop10.
Nmlp_2353 protein networkhttps://string-db.org/network/268739.Nmlp_2353PAC2 family protein.
Nmlp_2354 protein networkhttps://string-db.org/network/268739.Nmlp_2354Uncharacterized protein.
dapD protein networkhttps://string-db.org/network/268739.Nmlp_23552,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
aceA protein networkhttps://string-db.org/network/268739.Nmlp_2356Isocitrate lyase.
aceB protein networkhttps://string-db.org/network/268739.Nmlp_2357Malate synthase.
ham1 protein networkhttps://string-db.org/network/268739.Nmlp_2358Non-canonical purine NTP pyrophosphatase.
Nmlp_2359 protein networkhttps://string-db.org/network/268739.Nmlp_2359Uncharacterized protein.
Nmlp_2361 protein networkhttps://string-db.org/network/268739.Nmlp_2361Sulfate permease family protein.
Nmlp_2362 protein networkhttps://string-db.org/network/268739.Nmlp_2362Cyclin domain protein.
aglB protein networkhttps://string-db.org/network/268739.Nmlp_2363Dolichyl-monophosphooligosaccharide--protein glycotransferase AglB.
Nmlp_2364 protein networkhttps://string-db.org/network/268739.Nmlp_2364DUF368 family protein.
Nmlp_2365 protein networkhttps://string-db.org/network/268739.Nmlp_2365Probable rhomboid family protease.
rnp3 protein networkhttps://string-db.org/network/268739.Nmlp_2366Ribonuclease P protein component 3; Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends; Belongs to the eukaryotic/archaeal RNase P protein co [...]
Nmlp_2367 protein networkhttps://string-db.org/network/268739.Nmlp_2367Uncharacterized protein.
Nmlp_2368 protein networkhttps://string-db.org/network/268739.Nmlp_2368Uncharacterized protein.
Nmlp_2369 protein networkhttps://string-db.org/network/268739.Nmlp_2369Uncharacterized protein.
rnp2 protein networkhttps://string-db.org/network/268739.Nmlp_2370Ribonuclease P protein component 2; Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends; Belongs to the eukaryotic/archaeal RNase P protein co [...]
psmA protein networkhttps://string-db.org/network/268739.Nmlp_2371Proteasome alpha subunit; Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.
Nmlp_2372 protein networkhttps://string-db.org/network/268739.Nmlp_2372SBDS family protein.
qor2 protein networkhttps://string-db.org/network/268739.Nmlp_2373NADPH:quinone reductase.
Nmlp_2374 protein networkhttps://string-db.org/network/268739.Nmlp_2374Small CPxCG-related zinc finger protein.
Nmlp_2375 protein networkhttps://string-db.org/network/268739.Nmlp_2375ABC-type transport system ATP-binding protein.
Nmlp_2376 protein networkhttps://string-db.org/network/268739.Nmlp_2376ABC-type transport system permease protein.
Nmlp_2377 protein networkhttps://string-db.org/network/268739.Nmlp_2377ABC-type transport system permease protein.
Nmlp_2378 protein networkhttps://string-db.org/network/268739.Nmlp_2378Probable oxidoreductase (aldo-keto reductase family protein).
Nmlp_2379 protein networkhttps://string-db.org/network/268739.Nmlp_2379FMN-binding domain protein.
Nmlp_2380 protein networkhttps://string-db.org/network/268739.Nmlp_2380DUF2071 family protein.
Nmlp_2381 protein networkhttps://string-db.org/network/268739.Nmlp_2381DUF304 domain protein.
Nmlp_2382 protein networkhttps://string-db.org/network/268739.Nmlp_2382DUF304 domain protein.
Nmlp_2383 protein networkhttps://string-db.org/network/268739.Nmlp_2383Uncharacterized protein.
Nmlp_2384 protein networkhttps://string-db.org/network/268739.Nmlp_2384HAD superfamily hydrolase.
top6A protein networkhttps://string-db.org/network/268739.Nmlp_2385DNA topoisomerase 6 subunit A; Relaxes both positive and negative superturns and exhibits a strong decatenase activity; Belongs to the TOP6A family.
top6B protein networkhttps://string-db.org/network/268739.Nmlp_2386DNA topoisomerase 6 subunit B (intein-containing); Relaxes both positive and negative superturns and exhibits a strong decatenase activity.
gyrB protein networkhttps://string-db.org/network/268739.Nmlp_2388DNA gyrase subunit B; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in a [...]
gyrA protein networkhttps://string-db.org/network/268739.Nmlp_2389DNA gyrase subunit A; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in a [...]
Nmlp_2390 protein networkhttps://string-db.org/network/268739.Nmlp_2390Glyoxalase domain protein.
cdc48a protein networkhttps://string-db.org/network/268739.Nmlp_2391AAA-type ATPase (CDC48 subfamily).
Nmlp_2392 protein networkhttps://string-db.org/network/268739.Nmlp_2392HTH domain protein.
Nmlp_2393 protein networkhttps://string-db.org/network/268739.Nmlp_2393Uncharacterized protein.
ahbA protein networkhttps://string-db.org/network/268739.Nmlp_2396Siroheme decarboxylase AhbA; Product: histidine kinase (nonfunctional).
trpD2 protein networkhttps://string-db.org/network/268739.Nmlp_2397Probable phosphoribosyltransferase (homolog to anthranilate phosphoribosyltransferase).
Nmlp_2398 protein networkhttps://string-db.org/network/268739.Nmlp_2398Uncharacterized protein.
Nmlp_2399 protein networkhttps://string-db.org/network/268739.Nmlp_2399HTH domain protein.
ppiA protein networkhttps://string-db.org/network/268739.Nmlp_2400CYPL-type peptidylprolyl isomerase.
Nmlp_2401 protein networkhttps://string-db.org/network/268739.Nmlp_2401NUDIX family hydrolase.
Nmlp_2402 protein networkhttps://string-db.org/network/268739.Nmlp_2402Zinc finger protein.
Nmlp_2403 protein networkhttps://string-db.org/network/268739.Nmlp_2403Cupin 2 barrel domain protein.
tif2b1 protein networkhttps://string-db.org/network/268739.Nmlp_2404Translation initiation factor aIF-2 beta subunit.
Nmlp_2405 protein networkhttps://string-db.org/network/268739.Nmlp_2405FNT family transport protein.
Nmlp_2406 protein networkhttps://string-db.org/network/268739.Nmlp_2406UspA domain protein.
hmgA protein networkhttps://string-db.org/network/268739.Nmlp_2407hydroxymethylglutaryl-CoA reductase (NADPH); Belongs to the HMG-CoA reductase family.
nadA protein networkhttps://string-db.org/network/268739.Nmlp_2408Quinolinate synthase A; Catalyzes the condensation of iminoaspartate with dihydroxyacetone phosphate to form quinolinate.
nadB protein networkhttps://string-db.org/network/268739.Nmlp_2409L-aspartate oxidase.
nadC protein networkhttps://string-db.org/network/268739.Nmlp_2410Nicotinate-nucleotide pyrophosphorylase (carboxylating); Involved in the catabolism of quinolinic acid (QA). Belongs to the NadC/ModD family.
Nmlp_2411 protein networkhttps://string-db.org/network/268739.Nmlp_2411DUF3311 family protein.
Nmlp_2412 protein networkhttps://string-db.org/network/268739.Nmlp_2412SSSF family transport protein; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
Nmlp_2413 protein networkhttps://string-db.org/network/268739.Nmlp_2413PfpI family protease.
Nmlp_2414 protein networkhttps://string-db.org/network/268739.Nmlp_2414GtrA family protein.
Nmlp_2415 protein networkhttps://string-db.org/network/268739.Nmlp_2415AlkP-core domain protein.
Nmlp_2416 protein networkhttps://string-db.org/network/268739.Nmlp_2416DUF2892 family protein.
fabG2 protein networkhttps://string-db.org/network/268739.Nmlp_24173-oxoacyl-[acyl-carrier-protein] reductase.
Nmlp_2418 protein networkhttps://string-db.org/network/268739.Nmlp_2418Uncharacterized protein.
cheW protein networkhttps://string-db.org/network/268739.Nmlp_2419Purine-binding taxis protein CheW.
Nmlp_2420 protein networkhttps://string-db.org/network/268739.Nmlp_2420Uncharacterized protein.
arfA protein networkhttps://string-db.org/network/268739.Nmlp_2421GTP cyclohydrolase 3; Catalyzes the formation of 2-amino-5-formylamino-6- ribofuranosylamino-4(3H)-pyrimidinone ribonucleotide monophosphate and inorganic phosphate from GTP. Also has an independ [...]
livJ1 protein networkhttps://string-db.org/network/268739.Nmlp_2422ABC-type transport system periplasmic substrate-binding protein (probable substrate branched-chain amino acids).
livF1 protein networkhttps://string-db.org/network/268739.Nmlp_2423ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acids).
livG1 protein networkhttps://string-db.org/network/268739.Nmlp_2424ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acids).
livM1 protein networkhttps://string-db.org/network/268739.Nmlp_2425ABC-type transport system permease protein (probable substrate branched-chain amino acids).
livH1 protein networkhttps://string-db.org/network/268739.Nmlp_2426ABC-type transport system permease protein (probable substrate branched-chain amino acids).
pgk protein networkhttps://string-db.org/network/268739.Nmlp_2427Phosphoglycerate kinase; Belongs to the phosphoglycerate kinase family.
Nmlp_2428 protein networkhttps://string-db.org/network/268739.Nmlp_2428GNAT family acetyltransferase.
Nmlp_2429 protein networkhttps://string-db.org/network/268739.Nmlp_2429FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase).
rpoL protein networkhttps://string-db.org/network/268739.Nmlp_2430DNA-directed RNA polymerase subunit L; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...]
Nmlp_2431 protein networkhttps://string-db.org/network/268739.Nmlp_2431Uncharacterized protein.
hisF protein networkhttps://string-db.org/network/268739.Nmlp_2432Imidazoleglycerol-phosphate synthase subunit HisF; IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisF subunit catalyzes the cyclization activity that produ [...]
Nmlp_2433 protein networkhttps://string-db.org/network/268739.Nmlp_2433DMT superfamily transport protein.
Nmlp_2434 protein networkhttps://string-db.org/network/268739.Nmlp_2434Redoxin domain protein.
Nmlp_2435 protein networkhttps://string-db.org/network/268739.Nmlp_2435Probable methyltransferase.
mtfK1 protein networkhttps://string-db.org/network/268739.Nmlp_2436FKBP-type peptidylprolyl isomerase.
nolA1 protein networkhttps://string-db.org/network/268739.Nmlp_2437arNOG06768 family NADH-binding domain protein.
cetZ1 protein networkhttps://string-db.org/network/268739.Nmlp_2438FtsZ family protein CetZ, type III; Involved in cell shape control; Belongs to the CetZ family.
Nmlp_2439 protein networkhttps://string-db.org/network/268739.Nmlp_2439Uncharacterized protein.
cofC protein networkhttps://string-db.org/network/268739.Nmlp_24402-phospho-L-lactate guanylyltransferase; Guanylyltransferase that catalyzes the activation of phosphoenolpyruvate (PEP) as enolpyruvoyl-2-diphospho-5'-guanosine, via the condensation of PEP with [...]
cofG protein networkhttps://string-db.org/network/268739.Nmlp_24417,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 1; Catalyzes the radical-mediated synthesis of 7,8-didemethyl-8- hydroxy-5-deazariboflavin (FO) from 5-amino-5-(4-hydroxybenzyl)-6-(D- [...]
hsp20B protein networkhttps://string-db.org/network/268739.Nmlp_2442Hsp20-type molecular chaperone; Belongs to the small heat shock protein (HSP20) family.
Nmlp_2443 protein networkhttps://string-db.org/network/268739.Nmlp_2443Small CPxCG-related zinc finger protein.
Nmlp_2444 protein networkhttps://string-db.org/network/268739.Nmlp_2444Uncharacterized protein.
Nmlp_2445 protein networkhttps://string-db.org/network/268739.Nmlp_2445Uncharacterized protein.
Nmlp_2446 protein networkhttps://string-db.org/network/268739.Nmlp_2446Radical SAM domain protein.
Nmlp_2447 protein networkhttps://string-db.org/network/268739.Nmlp_2447HAD superfamily hydrolase.
cbiB protein networkhttps://string-db.org/network/268739.Nmlp_2448Adenosylcobinamide-phosphate synthase; Converts cobyric acid to cobinamide by the addition of aminopropanol on the F carboxylic group.
cobS protein networkhttps://string-db.org/network/268739.Nmlp_2449adenosylcobinamide-GDP ribazoletransferase; Joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Also synthesizes adenosylcobalamin 5'-phosphate from ade [...]
cobY protein networkhttps://string-db.org/network/268739.Nmlp_2450Adenosylcobinamide-phosphate guanylyltransferase.
cobD protein networkhttps://string-db.org/network/268739.Nmlp_2451L-threonine-O-3-phosphate decarboxylase.
cbiZ protein networkhttps://string-db.org/network/268739.Nmlp_2452Adenosylcobinamide amidohydrolase.
Nmlp_2453 protein networkhttps://string-db.org/network/268739.Nmlp_2453HTH-10 family transcription regulator.
Nmlp_2454 protein networkhttps://string-db.org/network/268739.Nmlp_2454Major facilitator superfamily transport protein.
PotD protein networkhttps://string-db.org/network/268739.Nmlp_2455ABC-type transport system periplasmic substrate-binding protein.
PotA protein networkhttps://string-db.org/network/268739.Nmlp_2456ABC-type transport system ATP-binding protein.
PotB protein networkhttps://string-db.org/network/268739.Nmlp_2457ABC-type transport system permease protein.
PotC protein networkhttps://string-db.org/network/268739.Nmlp_2458ABC-type transport system permease protein.
Nmlp_2461 protein networkhttps://string-db.org/network/268739.Nmlp_2461Uncharacterized protein; Product: ISH14-type transposase ISNamo10 (nonfunctional).
Nmlp_2462 protein networkhttps://string-db.org/network/268739.Nmlp_2462Uncharacterized protein.
Nmlp_2463 protein networkhttps://string-db.org/network/268739.Nmlp_2463Uncharacterized protein.
Nmlp_2464 protein networkhttps://string-db.org/network/268739.Nmlp_2464DoxX domain protein.
Nmlp_2465 protein networkhttps://string-db.org/network/268739.Nmlp_2465HiPIP domain protein.
Nmlp_2466 protein networkhttps://string-db.org/network/268739.Nmlp_2466SpoVR family protein.
Nmlp_2467 protein networkhttps://string-db.org/network/268739.Nmlp_2467UPF0229 family protein.
prkA2 protein networkhttps://string-db.org/network/268739.Nmlp_2469Probable PrkA-type serine/threonine protein kinase.
prkA1 protein networkhttps://string-db.org/network/268739.Nmlp_2470Probable PrkA-type serine/threonine protein kinase.
Nmlp_2471 protein networkhttps://string-db.org/network/268739.Nmlp_2471Uncharacterized protein.
cdd protein networkhttps://string-db.org/network/268739.Nmlp_2473Cytidine deaminase; Gene has frameshifts; locus_tag: Nmlp_2472; product: IS1341-type transposase NmIRS25 (nonfunctional); conceptual translation after in silico reconstruction: MEYSHRYPAYPTQQVVGE [...]
udp1 protein networkhttps://string-db.org/network/268739.Nmlp_2474Uridine phosphorylase.
ndh protein networkhttps://string-db.org/network/268739.Nmlp_2475Probable NADH dehydrogenase.
Nmlp_2476 protein networkhttps://string-db.org/network/268739.Nmlp_2476DUF293 domain protein.
Nmlp_2477 protein networkhttps://string-db.org/network/268739.Nmlp_2477P-type transport ATPase (probable substrate copper/metal cation).
cbaE protein networkhttps://string-db.org/network/268739.Nmlp_2478Ba3-type terminal oxidase subunit CbaE.
cbaD protein networkhttps://string-db.org/network/268739.Nmlp_2479Ba3-type terminal oxidase subunit CbaD.
cbaB protein networkhttps://string-db.org/network/268739.Nmlp_2480Ba3-type terminal oxidase subunit II.
cbaA protein networkhttps://string-db.org/network/268739.Nmlp_2481Ba3-type terminal oxidase subunit I.
cbaC protein networkhttps://string-db.org/network/268739.Nmlp_2482CbaC protein.
tspO protein networkhttps://string-db.org/network/268739.Nmlp_2483TspO family protein.
surE protein networkhttps://string-db.org/network/268739.Nmlp_24845'-nucleotidase SurE; Nucleotidase that shows phosphatase activity on nucleoside 5'-monophosphates; Belongs to the SurE nucleotidase family.
Nmlp_2485 protein networkhttps://string-db.org/network/268739.Nmlp_2485Beta-lactamase domain protein.
orc3 protein networkhttps://string-db.org/network/268739.Nmlp_2486Orc1-type DNA replication protein; Involved in regulation of DNA replication.
fadA5 protein networkhttps://string-db.org/network/268739.Nmlp_2487enoyl-CoA hydratase; Belongs to the enoyl-CoA hydratase/isomerase family.
BdbD protein networkhttps://string-db.org/network/268739.Nmlp_2488Thioredoxin domain protein.
Nmlp_2489 protein networkhttps://string-db.org/network/268739.Nmlp_2489Glyoxalase domain protein.
Nmlp_2490 protein networkhttps://string-db.org/network/268739.Nmlp_2490Uncharacterized protein.
Nmlp_2491 protein networkhttps://string-db.org/network/268739.Nmlp_2491IS1341-type transposase ISNamo20.
Nmlp_2492 protein networkhttps://string-db.org/network/268739.Nmlp_2492KaiC domain protein.
Nmlp_2493 protein networkhttps://string-db.org/network/268739.Nmlp_2493Sensor box histidine kinase.
Nmlp_2495 protein networkhttps://string-db.org/network/268739.Nmlp_2495Integrase family protein; Product: ABC-type transport system permease protein (nonfunctional).
Nmlp_2497 protein networkhttps://string-db.org/network/268739.Nmlp_2497ISH7-type transposase NmIRS21.
Nmlp_2498 protein networkhttps://string-db.org/network/268739.Nmlp_2498Uncharacterized protein.
Nmlp_2499 protein networkhttps://string-db.org/network/268739.Nmlp_2499NikR family transcription regulator.
Nmlp_2500 protein networkhttps://string-db.org/network/268739.Nmlp_2500Uncharacterized protein.
Nmlp_2501 protein networkhttps://string-db.org/network/268739.Nmlp_2501Uncharacterized protein.
parA3 protein networkhttps://string-db.org/network/268739.Nmlp_2502ParA domain protein.
polY2 protein networkhttps://string-db.org/network/268739.Nmlp_2504DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismat [...]
Nmlp_2505 protein networkhttps://string-db.org/network/268739.Nmlp_2505Uncharacterized protein.
Nmlp_2506 protein networkhttps://string-db.org/network/268739.Nmlp_2506Small CPxCG-related zinc finger protein.
Nmlp_2507 protein networkhttps://string-db.org/network/268739.Nmlp_2507Uncharacterized protein.
Nmlp_2508 protein networkhttps://string-db.org/network/268739.Nmlp_2508Uncharacterized protein.
Nmlp_2509 protein networkhttps://string-db.org/network/268739.Nmlp_2509ISH9-type transposase NmIRS1.
Nmlp_2510 protein networkhttps://string-db.org/network/268739.Nmlp_2510Uncharacterized protein; Gene has an in-frame stop codon and is truncated at the C-terminus; product: ISH9-type transposase NmIRS4 (nonfunctional); locus_tag: Nmlp_2509A.
tbp3 protein networkhttps://string-db.org/network/268739.Nmlp_2511TATA-binding transcription initiation factor; General factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Binds specifically to the TATA box promoter eleme [...]
CCQ36677.1 protein networkhttps://string-db.org/network/268739.Nmlp_2512AUncharacterized protein.
Nmlp_2513 protein networkhttps://string-db.org/network/268739.Nmlp_2513ISH10-type transposase ISNamo3.
Nmlp_2516 protein networkhttps://string-db.org/network/268739.Nmlp_2516Gene has an in-frame stop codon and is truncated at the N-terminus; product: ISH3-type transposase NmIRS57 (nonfunctional); locus_tag: Nmlp_2514A.
tbp2 protein networkhttps://string-db.org/network/268739.Nmlp_2517TATA-binding transcription initiation factor; General factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Binds specifically to the TATA box promoter eleme [...]
orc4 protein networkhttps://string-db.org/network/268739.Nmlp_2518Orc1-type DNA replication protein; Involved in regulation of DNA replication.
cbs13 protein networkhttps://string-db.org/network/268739.Nmlp_2519DUF21/CBS domain protein.
Nmlp_2521 protein networkhttps://string-db.org/network/268739.Nmlp_2521Probable FAD-dependent oxidoreductase.
Nmlp_2522 protein networkhttps://string-db.org/network/268739.Nmlp_2522Uncharacterized protein.
Nmlp_2525 protein networkhttps://string-db.org/network/268739.Nmlp_2525UPF0066 family protein; Gene has a frameshift; locus_tag: Nmlp_2524; product: ISH9-type transposase NmIRS2 (nonfunctional); conceptual translation after in silico reconstruction: MQALPESRLLRFVEQA [...]
Nmlp_2526 protein networkhttps://string-db.org/network/268739.Nmlp_2526Uncharacterized protein.
Nmlp_2527 protein networkhttps://string-db.org/network/268739.Nmlp_2527Uncharacterized protein.
Nmlp_2529 protein networkhttps://string-db.org/network/268739.Nmlp_2529PQQ repeat protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2528; product: ISH14-type transposase ISNamo7 (nonfunctional); conceptual translation after in silico re [...]
Nmlp_2530 protein networkhttps://string-db.org/network/268739.Nmlp_2530PQQ repeat protein / protein kinase domain protein.
Nmlp_2531 protein networkhttps://string-db.org/network/268739.Nmlp_2531Protein kinase domain protein.
Nmlp_2533 protein networkhttps://string-db.org/network/268739.Nmlp_2533DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico rec [...]
Nmlp_2535 protein networkhttps://string-db.org/network/268739.Nmlp_2535Protein kinase domain protein; Gene has in-frame stop codons; locus_tag: Nmlp_2534; product: ISH3-type transposase NmIRS13 (nonfunctional); conceptual translation after in silico reconstruction: [...]
Nmlp_2539 protein networkhttps://string-db.org/network/268739.Nmlp_2539Uncharacterized protein; Product: ISH14-type transposase NmIRS16 (nonfunctional).
Nmlp_2540 protein networkhttps://string-db.org/network/268739.Nmlp_2540Uncharacterized protein.
pspA2 protein networkhttps://string-db.org/network/268739.Nmlp_2541PspA domain protein.
Nmlp_2542 protein networkhttps://string-db.org/network/268739.Nmlp_2542AAA-type ATPase core domain protein; Belongs to the AAA ATPase family.
Nmlp_2543 protein networkhttps://string-db.org/network/268739.Nmlp_2543Uncharacterized protein.
prpC protein networkhttps://string-db.org/network/268739.Nmlp_2544Phosphoprotein phosphatase.
Nmlp_2545 protein networkhttps://string-db.org/network/268739.Nmlp_2545PQQ repeat protein / protein kinase domain protein.
Nmlp_2546 protein networkhttps://string-db.org/network/268739.Nmlp_2546Protein kinase domain protein.
Nmlp_2547 protein networkhttps://string-db.org/network/268739.Nmlp_2547ISHwa4-type transposase ISNamo5.
Nmlp_2549 protein networkhttps://string-db.org/network/268739.Nmlp_2549Protein kinase domain protein / halocyanin domain protein; Product: ISH14-type transposase ISNamo7 (nonfunctional).
Nmlp_2550 protein networkhttps://string-db.org/network/268739.Nmlp_2550ISH10-type transposase ISNamo3.
ferA3 protein networkhttps://string-db.org/network/268739.Nmlp_2556Ferredoxin (2Fe-2S).
dpsA3 protein networkhttps://string-db.org/network/268739.Nmlp_2557Ferritin / Dps domain protein.
Nmlp_2558 protein networkhttps://string-db.org/network/268739.Nmlp_2558HTH-10 family transcription regulator.
Nmlp_2559 protein networkhttps://string-db.org/network/268739.Nmlp_2559UPF0061 family protein.
Nmlp_2560 protein networkhttps://string-db.org/network/268739.Nmlp_2560TrmB family transcription regulator.
Nmlp_2561 protein networkhttps://string-db.org/network/268739.Nmlp_2561Uncharacterized protein.
Nmlp_2562 protein networkhttps://string-db.org/network/268739.Nmlp_2562Uncharacterized protein.
Nmlp_2563 protein networkhttps://string-db.org/network/268739.Nmlp_2563AbrB/VapB family protein.
Nmlp_2564 protein networkhttps://string-db.org/network/268739.Nmlp_2564Uncharacterized protein.
Nmlp_2565 protein networkhttps://string-db.org/network/268739.Nmlp_2565Uncharacterized protein.
Nmlp_2567 protein networkhttps://string-db.org/network/268739.Nmlp_2567Uncharacterized protein.
Nmlp_2568 protein networkhttps://string-db.org/network/268739.Nmlp_2568Uncharacterized protein.
Nmlp_2569 protein networkhttps://string-db.org/network/268739.Nmlp_2569HD family hydrolase.
Nmlp_2570 protein networkhttps://string-db.org/network/268739.Nmlp_2570ARM/HEAT repeat protein.
Nmlp_2572 protein networkhttps://string-db.org/network/268739.Nmlp_2572IS1341-type transposase ISNamo24; Gene has been targetted by a transposon; locus_tag: Nmlp_2571; product: small CPxCG-related zinc finger protein (nonfunctional); conceptual translation after in [...]
Nmlp_2574 protein networkhttps://string-db.org/network/268739.Nmlp_2574Uncharacterized protein; Gene has an in-frame stop codon; locus_tag: Nmlp_2573; product: homolog to small CPxCG-related zinc finger protein (nonfunctional); conceptual translation after in silico [...]
Nmlp_2575 protein networkhttps://string-db.org/network/268739.Nmlp_2575Uncharacterized protein.
Nmlp_2576 protein networkhttps://string-db.org/network/268739.Nmlp_2576AAA-type ATPase domain protein.
Nmlp_2577 protein networkhttps://string-db.org/network/268739.Nmlp_2577Uncharacterized protein.
Nmlp_2578 protein networkhttps://string-db.org/network/268739.Nmlp_2578Probable helicase.
Nmlp_2581 protein networkhttps://string-db.org/network/268739.Nmlp_2581UvrD/REP family helicase.
Nmlp_2582 protein networkhttps://string-db.org/network/268739.Nmlp_2582Homolog to nuclease subunit B.
Nmlp_2583 protein networkhttps://string-db.org/network/268739.Nmlp_2583AAA-type ATPase domain protein; Gene has an in-frame stop codon and is truncated at the C-terminus; product: ISH11-type transposase NmIRS56 (nonfunctional); locus_tag: Nmlp_2582A.
Nmlp_2584 protein networkhttps://string-db.org/network/268739.Nmlp_2584Homolog to 5-methylcytosine restriction system protein McrC.
Nmlp_2586 protein networkhttps://string-db.org/network/268739.Nmlp_2586ISH14-type transposase ISNamo7.
Nmlp_2587 protein networkhttps://string-db.org/network/268739.Nmlp_2587Uncharacterized protein.
Nmlp_2588 protein networkhttps://string-db.org/network/268739.Nmlp_2588Uncharacterized protein.
Nmlp_2589 protein networkhttps://string-db.org/network/268739.Nmlp_2589Adenine-specific DNA modification methylase.
Nmlp_2590 protein networkhttps://string-db.org/network/268739.Nmlp_2590ISH14-type transposase ISNamo13.
Nmlp_2592 protein networkhttps://string-db.org/network/268739.Nmlp_2592tRNA-Glu; anticodon=CTC.
folA1 protein networkhttps://string-db.org/network/268739.Nmlp_2593Dihydrofolate reductase; Belongs to the dihydrofolate reductase family.
hts protein networkhttps://string-db.org/network/268739.Nmlp_2594Thymidylate synthase; Catalyzes the reductive methylation of 2'-deoxyuridine-5'- monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate ( [...]
Nmlp_2595 protein networkhttps://string-db.org/network/268739.Nmlp_2595Cupin 2 barrel domain protein.
cre3n protein networkhttps://string-db.org/network/268739.Nmlp_2596Creatininase domain protein.
Nmlp_2597 protein networkhttps://string-db.org/network/268739.Nmlp_2597Integrase family protein.
cre2 protein networkhttps://string-db.org/network/268739.Nmlp_2598Creatininase domain protein.
Nmlp_2599 protein networkhttps://string-db.org/network/268739.Nmlp_2599Uncharacterized protein.
Nmlp_2600 protein networkhttps://string-db.org/network/268739.Nmlp_2600Uncharacterized protein.
Nmlp_2601 protein networkhttps://string-db.org/network/268739.Nmlp_2601Uncharacterized protein.
Nmlp_2602 protein networkhttps://string-db.org/network/268739.Nmlp_2602Uncharacterized protein.
Nmlp_2607 protein networkhttps://string-db.org/network/268739.Nmlp_2607Probable secreted glycoprotein; Product: uncharacterized protein (nonfunctional).
Nmlp_2609 protein networkhttps://string-db.org/network/268739.Nmlp_2609ISHwa16-type transposase ISNamo14.
Nmlp_2611 protein networkhttps://string-db.org/network/268739.Nmlp_2611ISH14-type transposase ISNamo13.
Nmlp_2612 protein networkhttps://string-db.org/network/268739.Nmlp_2612ISHwa16-type transposase ISNamo15.
Nmlp_2616 protein networkhttps://string-db.org/network/268739.Nmlp_2616Probable DEAD/DEAH box helicase.
Nmlp_2617 protein networkhttps://string-db.org/network/268739.Nmlp_2617Ribonuclease H domain protein.
Nmlp_2618 protein networkhttps://string-db.org/network/268739.Nmlp_2618Uncharacterized protein.
Nmlp_2619 protein networkhttps://string-db.org/network/268739.Nmlp_2619Uncharacterized protein.
znuB3 protein networkhttps://string-db.org/network/268739.Nmlp_2620ABC-type transport system permease protein (probable substrate zinc).
znuC3 protein networkhttps://string-db.org/network/268739.Nmlp_2621ABC-type transport system ATP-binding protein (probable substrate zinc).
znuA3 protein networkhttps://string-db.org/network/268739.Nmlp_2622ABC-type transport system periplasmic substrate-binding protein (probable substrate zinc).
Nmlp_2623 protein networkhttps://string-db.org/network/268739.Nmlp_2623Uncharacterized protein.
iscU2 protein networkhttps://string-db.org/network/268739.Nmlp_2625Iron-sulfur cluster assembly protein; Gene has a frameshift; locus_tag: Nmlp_2624; product: cobalt-factor-II C20-methyltransferase (nonfunctional); conceptual translation after in silico reconstr [...]
moaB2 protein networkhttps://string-db.org/network/268739.Nmlp_2626Molybdopterin adenylyltransferase.
Nmlp_2627 protein networkhttps://string-db.org/network/268739.Nmlp_2627CobW domain protein.
Nmlp_2628 protein networkhttps://string-db.org/network/268739.Nmlp_2628CobW domain protein.
Nmlp_2629 protein networkhttps://string-db.org/network/268739.Nmlp_2629NikR family transcription regulator; Transcriptional regulator; Belongs to the transcriptional regulatory CopG/NikR family.
Nmlp_2630 protein networkhttps://string-db.org/network/268739.Nmlp_2630ISH3-type transposase ISNamo6.
Nmlp_2632 protein networkhttps://string-db.org/network/268739.Nmlp_2632NikR family transcription regulator; Product: IS1341-type transposase NmIRS29 (nonfunctional).
CbiO protein networkhttps://string-db.org/network/268739.Nmlp_2634ABC-type transport system ATP-binding protein (probable substrate cobalt/nickel/biotin).
CbiQ protein networkhttps://string-db.org/network/268739.Nmlp_2635ABC-type transport system permease protein (probable substrate cobalt/nickel/biotin).
Nmlp_2636 protein networkhttps://string-db.org/network/268739.Nmlp_2636ABC-type transport system small membrane protein (probable substrate cobalt/nickel/biotin).
CbiM protein networkhttps://string-db.org/network/268739.Nmlp_2637ABC-type transport system permease protein (probable substrate cobalt/nickel/biotin).
Nmlp_2638 protein networkhttps://string-db.org/network/268739.Nmlp_2638NikR family transcription regulator.
Nmlp_2639 protein networkhttps://string-db.org/network/268739.Nmlp_2639NikR family transcription regulator; Transcriptional regulator; Belongs to the transcriptional regulatory CopG/NikR family.
Nmlp_2640 protein networkhttps://string-db.org/network/268739.Nmlp_2640UPF0175 family protein.
Nmlp_2641 protein networkhttps://string-db.org/network/268739.Nmlp_2641PIN domain protein.
parA2 protein networkhttps://string-db.org/network/268739.Nmlp_2642ParA domain protein.
Nmlp_2643 protein networkhttps://string-db.org/network/268739.Nmlp_2643Uncharacterized protein.
Nmlp_2645 protein networkhttps://string-db.org/network/268739.Nmlp_2645DUF3006 family protein; Gene has an in-frame stop codon; locus_tag: Nmlp_2644; product: beta-lactamase domain protein (nonfunctional); conceptual translation after in silico reconstruction: MKRLH [...]
Nmlp_2646 protein networkhttps://string-db.org/network/268739.Nmlp_2646Homolog to restriction system mrr N-terminal region.
Nmlp_2647 protein networkhttps://string-db.org/network/268739.Nmlp_2647Uncharacterized protein.
Nmlp_2648 protein networkhttps://string-db.org/network/268739.Nmlp_2648HTH domain protein.
Nmlp_2649 protein networkhttps://string-db.org/network/268739.Nmlp_2649ArsR family transcription regulator / DUF2204 family protein.
Nmlp_2650 protein networkhttps://string-db.org/network/268739.Nmlp_2650Probable secreted glycoprotein.
Nmlp_2651 protein networkhttps://string-db.org/network/268739.Nmlp_2651IS1341-type transposase ISNamo25.
Nmlp_2652 protein networkhttps://string-db.org/network/268739.Nmlp_2652Uncharacterized protein.
Nmlp_2653 protein networkhttps://string-db.org/network/268739.Nmlp_2653Receiver/bat box HTH-10 family transcription regulator.
Nmlp_2654 protein networkhttps://string-db.org/network/268739.Nmlp_2654Histidine kinase.
Nmlp_2655 protein networkhttps://string-db.org/network/268739.Nmlp_2655Probable secreted glycoprotein.
orc5 protein networkhttps://string-db.org/network/268739.Nmlp_2657Orc1-type DNA replication protein; Involved in regulation of DNA replication.
Nmlp_2658 protein networkhttps://string-db.org/network/268739.Nmlp_2658Uncharacterized protein.
Nmlp_2659 protein networkhttps://string-db.org/network/268739.Nmlp_2659MazG family protein.
Nmlp_2660 protein networkhttps://string-db.org/network/268739.Nmlp_2660Probable ATP/GTP-binding protein.
Nmlp_2661 protein networkhttps://string-db.org/network/268739.Nmlp_2661Uncharacterized protein.
Nmlp_2662 protein networkhttps://string-db.org/network/268739.Nmlp_2662Uncharacterized protein.
Nmlp_2663 protein networkhttps://string-db.org/network/268739.Nmlp_2663HTH domain protein.
Nmlp_2664 protein networkhttps://string-db.org/network/268739.Nmlp_2664Uncharacterized protein.
Nmlp_2665 protein networkhttps://string-db.org/network/268739.Nmlp_2665IS200-type transposase ISNamo17.
Nmlp_2666 protein networkhttps://string-db.org/network/268739.Nmlp_2666IS1341-type transposase ISNamo17.
tfbA6 protein networkhttps://string-db.org/network/268739.Nmlp_2668Transcription initiation factor TFB; Product: PIN domain protein (nonfunctional).
cspA2 protein networkhttps://string-db.org/network/268739.Nmlp_2669Cold shock protein.
Nmlp_2671 protein networkhttps://string-db.org/network/268739.Nmlp_2671Nucleotidyltransferase domain protein.
Nmlp_2672 protein networkhttps://string-db.org/network/268739.Nmlp_2672DUF86 family protein.
Nmlp_2673 protein networkhttps://string-db.org/network/268739.Nmlp_2673Uncharacterized protein.
Nmlp_2675 protein networkhttps://string-db.org/network/268739.Nmlp_2675Uncharacterized protein.
Nmlp_2676 protein networkhttps://string-db.org/network/268739.Nmlp_2676Uncharacterized protein.
Nmlp_2677 protein networkhttps://string-db.org/network/268739.Nmlp_2677Uncharacterized protein.
Nmlp_2678 protein networkhttps://string-db.org/network/268739.Nmlp_2678Uncharacterized protein.
Nmlp_2680 protein networkhttps://string-db.org/network/268739.Nmlp_2680FMO domain protein; Gene has an in-frame stop codon and is truncated at both termini; product: ISH9-type transposase NmIRS4 (nonfunctional); locus_tag: Nmlp_2679B.
Nmlp_2682 protein networkhttps://string-db.org/network/268739.Nmlp_2682Uncharacterized protein; Gene has a frameshift and is truncated at the C-terminus; locus_tag: Nmlp_2681; product: ISH9-type transposase NmIRS5 (nonfunctional).
Nmlp_2683 protein networkhttps://string-db.org/network/268739.Nmlp_2683Uncharacterized protein.
Nmlp_2684 protein networkhttps://string-db.org/network/268739.Nmlp_2684Uncharacterized protein.
Nmlp_2685 protein networkhttps://string-db.org/network/268739.Nmlp_2685Uncharacterized protein.
phr3 protein networkhttps://string-db.org/network/268739.Nmlp_2686Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family.
rtcB1 protein networkhttps://string-db.org/network/268739.Nmlp_2687tRNA-splicing ligase RtcB; Belongs to the RtcB family.
cheB protein networkhttps://string-db.org/network/268739.Nmlp_2688Protein-glutamate methylesterase CheB; Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylatio [...]
cheA protein networkhttps://string-db.org/network/268739.Nmlp_2689Taxis sensor histidine kinase CheA.
cheR protein networkhttps://string-db.org/network/268739.Nmlp_2690Protein-glutamate O-methyltransferase CheR.
Nmlp_2691 protein networkhttps://string-db.org/network/268739.Nmlp_2691HEAT-PBS family taxis protein.
cheF1 protein networkhttps://string-db.org/network/268739.Nmlp_2692Taxis protein CheF1.
dph2 protein networkhttps://string-db.org/network/268739.Nmlp_26932-(3-amino-3-carboxypropyl)histidine synthase; Catalyzes the first step of diphthamide biosynthesis, i.e. the transfer of the 3-amino-3-carboxypropyl group from S-adenosyl-L- methionine (SAM) to [...]
Nmlp_2694 protein networkhttps://string-db.org/network/268739.Nmlp_2694DUF964 family protein.
Nmlp_2695 protein networkhttps://string-db.org/network/268739.Nmlp_2695Metal-dependent hydrolase domain protein.
Nmlp_2696 protein networkhttps://string-db.org/network/268739.Nmlp_2696Probable coiled coil protein.
Nmlp_2697 protein networkhttps://string-db.org/network/268739.Nmlp_2697Uncharacterized protein.
Nmlp_2698 protein networkhttps://string-db.org/network/268739.Nmlp_2698XerC/D-like integrase.
Nmlp_2699 protein networkhttps://string-db.org/network/268739.Nmlp_2699Uncharacterized protein.
Nmlp_2701 protein networkhttps://string-db.org/network/268739.Nmlp_2701ISH7-type transposase NmIRS22.
Nmlp_2702 protein networkhttps://string-db.org/network/268739.Nmlp_2702Uncharacterized protein.
Nmlp_2704 protein networkhttps://string-db.org/network/268739.Nmlp_2704UPF0175 family protein; Gene has an in-frame stop codon; locus_tag: Nmlp_2703; product: PIN domain protein (nonfunctional); conceptual translation after in silico reconstruction: MTGDDIPANPSVLNTT [...]
CDN30045.1 protein networkhttps://string-db.org/network/268739.Nmlp_2704AUncharacterized protein.
Nmlp_2705 protein networkhttps://string-db.org/network/268739.Nmlp_2705DUF964 family protein.
arsA4 protein networkhttps://string-db.org/network/268739.Nmlp_2706ArsA-type transport ATPase (probable substrate arsenite).
arsD1 protein networkhttps://string-db.org/network/268739.Nmlp_2707Transcription regulator ArsD.
Nmlp_2708 protein networkhttps://string-db.org/network/268739.Nmlp_2708ArsR family transcription regulator.
Nmlp_2709 protein networkhttps://string-db.org/network/268739.Nmlp_2709Uncharacterized protein.
Nmlp_2710 protein networkhttps://string-db.org/network/268739.Nmlp_2710Transport protein (probable substrate arsenite).
arsM protein networkhttps://string-db.org/network/268739.Nmlp_2711Probable arsenite(III)-methyltransferase.
arsC1 protein networkhttps://string-db.org/network/268739.Nmlp_2712Arsenate reductase (glutaredoxin).
Nmlp_2713 protein networkhttps://string-db.org/network/268739.Nmlp_2713ArsR family transcription regulator.
fdhA protein networkhttps://string-db.org/network/268739.Nmlp_2714Formate dehydrogenase alpha subunit.
Nmlp_2715 protein networkhttps://string-db.org/network/268739.Nmlp_2715ABC-type transport system ATP-binding protein.
acaB1 protein networkhttps://string-db.org/network/268739.Nmlp_2716acetyl-CoA C-acetyltransferase catalytic subunit.
Nmlp_2717 protein networkhttps://string-db.org/network/268739.Nmlp_2717acetyl-CoA C-acetyltransferase small subunit.
Nmlp_2718 protein networkhttps://string-db.org/network/268739.Nmlp_2718Uncharacterized protein.
Nmlp_2719 protein networkhttps://string-db.org/network/268739.Nmlp_2719Uncharacterized protein.
dpsA1 protein networkhttps://string-db.org/network/268739.Nmlp_2720Ferritin DpsA; Belongs to the Dps family.
rpl8e protein networkhttps://string-db.org/network/268739.Nmlp_272250S ribosomal protein L8e; Multifunctional RNA-binding protein that recognizes the K- turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.
rps28e protein networkhttps://string-db.org/network/268739.Nmlp_272330S ribosomal protein S28e; Belongs to the eukaryotic ribosomal protein eS28 family.
rpl24e protein networkhttps://string-db.org/network/268739.Nmlp_272450S ribosomal protein L24e; Binds to the 23S rRNA; Belongs to the eukaryotic ribosomal protein eL24 family.
ndk protein networkhttps://string-db.org/network/268739.Nmlp_2725Nucleoside-diphosphate kinase; Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, [...]
metE1 protein networkhttps://string-db.org/network/268739.Nmlp_27265-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase (methionine synthase II).
metE2 protein networkhttps://string-db.org/network/268739.Nmlp_27275-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase (methionine synthase II).
prmC protein networkhttps://string-db.org/network/268739.Nmlp_2728Probable S-adenosylmethionine-dependent methyltransferase PrmC.
Nmlp_2729 protein networkhttps://string-db.org/network/268739.Nmlp_2729Uncharacterized protein.
ksgA protein networkhttps://string-db.org/network/268739.Nmlp_2730Ribosome biogenesis protein KsgA, 16S rRNA-methylating; Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May p [...]
Nmlp_2731 protein networkhttps://string-db.org/network/268739.Nmlp_2731Putative tRNA-specific adenosine deaminase.
rpoF protein networkhttps://string-db.org/network/268739.Nmlp_2732DNA-directed RNA polymerase subunit F.
rpl21e protein networkhttps://string-db.org/network/268739.Nmlp_273350S ribosomal protein L21e; Belongs to the eukaryotic ribosomal protein eL21 family.
tef1b protein networkhttps://string-db.org/network/268739.Nmlp_2734Translation elongation factor aEF-1 beta subunit; Promotes the exchange of GDP for GTP in EF-1-alpha/GDP, thus allowing the regeneration of EF-1-alpha/GTP that could then be used to form the tern [...]
Nmlp_2735 protein networkhttps://string-db.org/network/268739.Nmlp_2735Small CPxCG-related zinc finger protein.
tmcA protein networkhttps://string-db.org/network/268739.Nmlp_2736tRNA(Met) cytidine acetyltransferase TmcA; Catalyzes the formation of N(4)-acetylcytidine (ac(4)C) at the wobble position of tRNA(Met), by using acetyl-CoA as an acetyl donor and ATP (or GTP).
ferB1 protein networkhttps://string-db.org/network/268739.Nmlp_2737Ferredoxin (3Fe-4S)(4Fe-4S), zinc-containing.
gltS protein networkhttps://string-db.org/network/268739.Nmlp_2738glutamate--tRNA(Glu/Gln) ligase; Catalyzes the attachment of glutamate to tRNA(Glu) in a two- step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the accept [...]
idsA1 protein networkhttps://string-db.org/network/268739.Nmlp_2739Bifunctional short chain isoprenyl diphosphate synthase; Belongs to the FPP/GGPP synthase family.
rnj protein networkhttps://string-db.org/network/268739.Nmlp_2740Ribonuclease J; An RNase that has 5'-3' exonuclease activity. May be involved in RNA degradation; Belongs to the metallo-beta-lactamase superfamily. RNA- metabolizing metallo-beta-lactamase-like [...]
Nmlp_2741 protein networkhttps://string-db.org/network/268739.Nmlp_2741Isopentenyl phosphate kinase; Catalyzes the phosphorylation of isopentenyl phosphate (IP) to isopentenyl diphosphate (IPP). Functions in an alternate mevalonate (MVA) pathway leading to IPP, a ke [...]
mvk protein networkhttps://string-db.org/network/268739.Nmlp_2742Mevalonate kinase; Catalyzes the phosphorylation of (R)-mevalonate (MVA) to (R)- mevalonate 5-phosphate (MVAP). Functions in the mevalonate (MVA) pathway leading to isopentenyl diphosphate (IPP), [...]
nosL2 protein networkhttps://string-db.org/network/268739.Nmlp_2743NosL family protein.
Nmlp_2744 protein networkhttps://string-db.org/network/268739.Nmlp_2744Uncharacterized protein.
rps2 protein networkhttps://string-db.org/network/268739.Nmlp_274530S ribosomal protein S2; Belongs to the universal ribosomal protein uS2 family.
eno protein networkhttps://string-db.org/network/268739.Nmlp_2746Enolase; Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. It is essential for the degradation of carbohydrates via glycolysis; Belongs to the enolase family.
rpoK protein networkhttps://string-db.org/network/268739.Nmlp_2747DNA-directed RNA polymerase subunit K; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...]
rpoN protein networkhttps://string-db.org/network/268739.Nmlp_2748DNA-directed RNA polymerase subunit N; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...]
rps9 protein networkhttps://string-db.org/network/268739.Nmlp_274930S ribosomal protein S9; Belongs to the universal ribosomal protein uS9 family.
rpl13 protein networkhttps://string-db.org/network/268739.Nmlp_275050S ribosomal protein L13; This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages [...]
rpl18e protein networkhttps://string-db.org/network/268739.Nmlp_275150S ribosomal protein L18e; Belongs to the eukaryotic ribosomal protein eL18 family.
rpoD protein networkhttps://string-db.org/network/268739.Nmlp_2752DNA-directed RNA polymerase subunit D; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...]
rps11 protein networkhttps://string-db.org/network/268739.Nmlp_275330S ribosomal protein S11; Located on the platform of the 30S subunit. Belongs to the universal ribosomal protein uS11 family.
rps4 protein networkhttps://string-db.org/network/268739.Nmlp_275430S ribosomal protein S4; One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit.
rps13 protein networkhttps://string-db.org/network/268739.Nmlp_275530S ribosomal protein S13; Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 [...]
apbC1 protein networkhttps://string-db.org/network/268739.Nmlp_2756Fe-S cluster carrier protein ApbC; Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP; Belongs to the Mrp/NBP35 ATP-binding proteins family.
Nmlp_2757 protein networkhttps://string-db.org/network/268739.Nmlp_2757Uncharacterized protein.
Nmlp_2758 protein networkhttps://string-db.org/network/268739.Nmlp_2758PQQ repeat protein.
rps6e protein networkhttps://string-db.org/network/268739.Nmlp_275930S ribosomal protein S6e; Belongs to the eukaryotic ribosomal protein eS6 family.
Nmlp_2760 protein networkhttps://string-db.org/network/268739.Nmlp_2760Uncharacterized protein.
coaBC protein networkhttps://string-db.org/network/268739.Nmlp_2761Phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase.
Nmlp_2762 protein networkhttps://string-db.org/network/268739.Nmlp_2762START domain protein.
Nmlp_2763 protein networkhttps://string-db.org/network/268739.Nmlp_2763Uncharacterized protein.
moeA1 protein networkhttps://string-db.org/network/268739.Nmlp_2764Molybdopterin molybdenumtransferase.
moeA2 protein networkhttps://string-db.org/network/268739.Nmlp_2765Molybdopterin molybdenumtransferase.
Nmlp_2766 protein networkhttps://string-db.org/network/268739.Nmlp_2766Uncharacterized protein.
hsp20C protein networkhttps://string-db.org/network/268739.Nmlp_2767Hsp20-type molecular chaperone; Belongs to the small heat shock protein (HSP20) family.
Nmlp_2768 protein networkhttps://string-db.org/network/268739.Nmlp_2768UbiB family protein.
tfeA protein networkhttps://string-db.org/network/268739.Nmlp_2769Transcription initiation factor TFE; Transcription factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Facilitates transcription initiation by enhancing TA [...]
Nmlp_2770 protein networkhttps://string-db.org/network/268739.Nmlp_2770DUF2110 family protein.
Nmlp_2771 protein networkhttps://string-db.org/network/268739.Nmlp_2771Uncharacterized protein.
CinA1 protein networkhttps://string-db.org/network/268739.Nmlp_2772ADP-ribose pyrophosphatase.
Nmlp_2773 protein networkhttps://string-db.org/network/268739.Nmlp_2773Uncharacterized protein.
Nmlp_2774 protein networkhttps://string-db.org/network/268739.Nmlp_2774Homolog to NAD kinase.
grx4 protein networkhttps://string-db.org/network/268739.Nmlp_2775Glutaredoxin.
tssA2 protein networkhttps://string-db.org/network/268739.Nmlp_2776Rhodanese domain protein.
tssA1 protein networkhttps://string-db.org/network/268739.Nmlp_2777Rhodanese domain protein.
Nmlp_2778 protein networkhttps://string-db.org/network/268739.Nmlp_2778Ferritin domain protein.
Nmlp_2779 protein networkhttps://string-db.org/network/268739.Nmlp_2779Uncharacterized protein.
Nmlp_2780 protein networkhttps://string-db.org/network/268739.Nmlp_2780IS1341-type transposase ISNamo26.
purM protein networkhttps://string-db.org/network/268739.Nmlp_2781Phosphoribosylformylglycinamidine cyclo-ligase.
Nmlp_2782 protein networkhttps://string-db.org/network/268739.Nmlp_2782M50 family metalloprotease.
Nmlp_2783 protein networkhttps://string-db.org/network/268739.Nmlp_2783TraB family protein.
Nmlp_2784 protein networkhttps://string-db.org/network/268739.Nmlp_2784UspA domain protein.
Nmlp_2785 protein networkhttps://string-db.org/network/268739.Nmlp_2785Uncharacterized protein.
Nmlp_2787 protein networkhttps://string-db.org/network/268739.Nmlp_2787Uncharacterized protein.
Nmlp_2788 protein networkhttps://string-db.org/network/268739.Nmlp_2788Uncharacterized protein.
Nmlp_2789 protein networkhttps://string-db.org/network/268739.Nmlp_2789UPF0098 family protein.
Nmlp_2790 protein networkhttps://string-db.org/network/268739.Nmlp_2790Uncharacterized protein.
Nmlp_2791 protein networkhttps://string-db.org/network/268739.Nmlp_2791Uncharacterized protein.
flaD protein networkhttps://string-db.org/network/268739.Nmlp_2792Fla cluster protein FlaD.
Nmlp_2793 protein networkhttps://string-db.org/network/268739.Nmlp_2793Rhodanese domain protein / beta-lactamase domain protein.
copA protein networkhttps://string-db.org/network/268739.Nmlp_2794P-type transport ATPase (probable substrate copper/metal cation).
Nmlp_2795 protein networkhttps://string-db.org/network/268739.Nmlp_2795Lrp/AsnC family transcription regulator.
Nmlp_2796 protein networkhttps://string-db.org/network/268739.Nmlp_2796DUF309 family protein.
Nmlp_2799 protein networkhttps://string-db.org/network/268739.Nmlp_2799DUF3006 family protein.
Nmlp_2800 protein networkhttps://string-db.org/network/268739.Nmlp_2800Uncharacterized protein.
suhB protein networkhttps://string-db.org/network/268739.Nmlp_2801Probable inositol-1(or 4)-monophosphatase / fructose-1,6-bisphosphatase, archaeal-type.
Nmlp_2802 protein networkhttps://string-db.org/network/268739.Nmlp_2802DUF63 family protein.
arsC2 protein networkhttps://string-db.org/network/268739.Nmlp_2803Arsenate reductase (glutaredoxin).
phoU4 protein networkhttps://string-db.org/network/268739.Nmlp_2804PhoU domain protein.
phoU3 protein networkhttps://string-db.org/network/268739.Nmlp_2805PhoU domain protein; Plays a role in the regulation of phosphate uptake.
pstB2 protein networkhttps://string-db.org/network/268739.Nmlp_2806ABC-type transport system ATP-binding protein (probable substrate phosphate); Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the tran [...]
pstA1 protein networkhttps://string-db.org/network/268739.Nmlp_2807ABC-type transport system permease protein (probable substrate phosphate).
pstC2 protein networkhttps://string-db.org/network/268739.Nmlp_2808ABC-type transport system permease protein (probable substrate phosphate); Part of the binding-protein-dependent transport system for phosphate; probably responsible for the translocation of the [...]
pstS1 protein networkhttps://string-db.org/network/268739.Nmlp_2809ABC-type transport system periplasmic substrate-binding protein (probable substrate phosphate).
Nmlp_2810 protein networkhttps://string-db.org/network/268739.Nmlp_2810Uncharacterized protein.
Nmlp_2811 protein networkhttps://string-db.org/network/268739.Nmlp_2811Uncharacterized protein.
Nmlp_2812 protein networkhttps://string-db.org/network/268739.Nmlp_2812Uncharacterized protein.
Nmlp_2813 protein networkhttps://string-db.org/network/268739.Nmlp_2813DHH/RecJ family phosphoesterase.
Nmlp_2814 protein networkhttps://string-db.org/network/268739.Nmlp_2814PRC domain protein.
trxA3 protein networkhttps://string-db.org/network/268739.Nmlp_2815Thioredoxin.
Nmlp_2816 protein networkhttps://string-db.org/network/268739.Nmlp_2816DRTGG domain protein.
acdA protein networkhttps://string-db.org/network/268739.Nmlp_2817acetate--CoA ligase (ADP-forming).
znuB2 protein networkhttps://string-db.org/network/268739.Nmlp_2818ABC-type transport system permease protein (probable substrate zinc).
znuC2 protein networkhttps://string-db.org/network/268739.Nmlp_2818AABC-type transport system ATP-binding protein (probable substrate zinc).
znuA2 protein networkhttps://string-db.org/network/268739.Nmlp_2819ABC-type transport system periplasmic substrate-binding protein (probable substrate zinc).
ybaK protein networkhttps://string-db.org/network/268739.Nmlp_2820YbaK domain protein.
Nmlp_2821 protein networkhttps://string-db.org/network/268739.Nmlp_2821Beta-lactamase domain protein.
Nmlp_2822 protein networkhttps://string-db.org/network/268739.Nmlp_2822Uncharacterized protein.
trpB2 protein networkhttps://string-db.org/network/268739.Nmlp_2823Tryptophan synthase beta subunit; The beta subunit is responsible for the synthesis of L- tryptophan from indole and L-serine.
Nmlp_2824 protein networkhttps://string-db.org/network/268739.Nmlp_2824Probable oxidoreductase (short-chain dehydrogenase family); Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Nmlp_2825 protein networkhttps://string-db.org/network/268739.Nmlp_2825Probable secreted glycoprotein.
gufA1 protein networkhttps://string-db.org/network/268739.Nmlp_2826GufA family transport protein (probable substrate zinc).
Nmlp_2827 protein networkhttps://string-db.org/network/268739.Nmlp_2827Uncharacterized protein.
purD protein networkhttps://string-db.org/network/268739.Nmlp_2828Phosphoribosylamine--glycine ligase; Belongs to the GARS family.
Nmlp_2830 protein networkhttps://string-db.org/network/268739.Nmlp_2830Uncharacterized protein.
Nmlp_2831 protein networkhttps://string-db.org/network/268739.Nmlp_2831YyaL family protein.
gdhA protein networkhttps://string-db.org/network/268739.Nmlp_2833Glutamate dehydrogenase; Gene has frameshifts; locus_tag: Nmlp_2832; product: homolog to citrate lyase beta subunit (nonfunctional); conceptual translation after in silico reconstruction: MARRSVL [...]
tyrS protein networkhttps://string-db.org/network/268739.Nmlp_2837tyrosine--tRNA ligase.
Nmlp_2838 protein networkhttps://string-db.org/network/268739.Nmlp_2838Sensor box histidine kinase.
Nmlp_2840 protein networkhttps://string-db.org/network/268739.Nmlp_2840Uncharacterized protein; Product: HxlR family transcription regulator (nonfunctional).
bdhA2 protein networkhttps://string-db.org/network/268739.Nmlp_28413-hydroxybutyrate dehydrogenase.
moaA protein networkhttps://string-db.org/network/268739.Nmlp_2842Probable cyclic pyranopterin monophosphate synthase; Catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate; Belongs to the radical SAM superfamily. MoaA family [...]
Nmlp_2843 protein networkhttps://string-db.org/network/268739.Nmlp_2843Homolog to phage PhiH1 repressor protein.
Nmlp_2844 protein networkhttps://string-db.org/network/268739.Nmlp_2844Uncharacterized protein.
pus10 protein networkhttps://string-db.org/network/268739.Nmlp_2845tRNA pseudouridine synthase Pus10; Responsible for synthesis of pseudouridine from uracil-54 and uracil-55 in the psi GC loop of transfer RNAs.
pmm3 protein networkhttps://string-db.org/network/268739.Nmlp_2846Phosphohexomutase (phosphoglucomutase / phosphomannomutase); Belongs to the phosphohexose mutase family.
Nmlp_2847 protein networkhttps://string-db.org/network/268739.Nmlp_2847Uncharacterized protein.
Nmlp_2848 protein networkhttps://string-db.org/network/268739.Nmlp_2848Uncharacterized protein.
Nmlp_2849 protein networkhttps://string-db.org/network/268739.Nmlp_2849Uncharacterized protein.
SpeE protein networkhttps://string-db.org/network/268739.Nmlp_2850Polyamine aminopropyltransferase.
Nmlp_2851 protein networkhttps://string-db.org/network/268739.Nmlp_2851Uncharacterized protein.
hemAT2 protein networkhttps://string-db.org/network/268739.Nmlp_2852Transducer protein HemAT.
Nmlp_2853 protein networkhttps://string-db.org/network/268739.Nmlp_2853Sensor box histidine kinase.
Nmlp_2854 protein networkhttps://string-db.org/network/268739.Nmlp_2854Sensor box histidine kinase.
Nmlp_2856 protein networkhttps://string-db.org/network/268739.Nmlp_2856UPF0212 family protein; Belongs to the UPF0212 family.
Nmlp_2857 protein networkhttps://string-db.org/network/268739.Nmlp_2857DNA N-glycosylase.
Nmlp_2858 protein networkhttps://string-db.org/network/268739.Nmlp_2858Uncharacterized protein.
Nmlp_2859 protein networkhttps://string-db.org/network/268739.Nmlp_2859Probable secreted glycoprotein.
acyP protein networkhttps://string-db.org/network/268739.Nmlp_2860Acylphosphatase.
nnrDE protein networkhttps://string-db.org/network/268739.Nmlp_2861Bifunctional NAD(P)H-hydrate repair enzyme Nnr; Bifunctional enzyme that catalyzes the epimerization of the S- and R-forms of NAD(P)HX and the dehydration of the S-form of NAD(P)HX at the expense [...]
moaC protein networkhttps://string-db.org/network/268739.Nmlp_2862Probable cyclic pyranopterin monophosphate synthase accessory protein; Catalyzes the conversion of (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP [...]
hflX protein networkhttps://string-db.org/network/268739.Nmlp_2863Ribosome-associating GTPase HflX; GTPase that associates with the 50S ribosomal subunit and may have a role during protein synthesis or ribosome biogenesis. Belongs to the TRAFAC class OBG-HflX-l [...]
cbs8 protein networkhttps://string-db.org/network/268739.Nmlp_2864HTH/CBS domain protein.
Nmlp_2865 protein networkhttps://string-db.org/network/268739.Nmlp_2865UPF0212 family protein; Belongs to the UPF0212 family.
psmB protein networkhttps://string-db.org/network/268739.Nmlp_2866Proteasome beta subunit; Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.
ligB protein networkhttps://string-db.org/network/268739.Nmlp_2867DNA ligase (ATP); DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair.
Nmlp_2868 protein networkhttps://string-db.org/network/268739.Nmlp_2868Metal-dependent hydrolase domain protein.
Nmlp_2869 protein networkhttps://string-db.org/network/268739.Nmlp_2869Uncharacterized protein.
Nmlp_2870 protein networkhttps://string-db.org/network/268739.Nmlp_2870Uncharacterized protein.
Nmlp_2871 protein networkhttps://string-db.org/network/268739.Nmlp_2871Uncharacterized protein.
dna2 protein networkhttps://string-db.org/network/268739.Nmlp_2872ATP-dependent DNA helicase Dna2.
Nmlp_2873 protein networkhttps://string-db.org/network/268739.Nmlp_2873Uncharacterized protein.
Nmlp_2874 protein networkhttps://string-db.org/network/268739.Nmlp_2874Uncharacterized protein.
Nmlp_2875 protein networkhttps://string-db.org/network/268739.Nmlp_2875Small CPxCG-related zinc finger protein.
Nmlp_2876 protein networkhttps://string-db.org/network/268739.Nmlp_2876DUF2342 family protein.
grx3 protein networkhttps://string-db.org/network/268739.Nmlp_2877Glutaredoxin.
Nmlp_2878 protein networkhttps://string-db.org/network/268739.Nmlp_2878Uncharacterized protein.
Nmlp_2879 protein networkhttps://string-db.org/network/268739.Nmlp_2879Peroxiredoxin domain protein.
Nmlp_2880 protein networkhttps://string-db.org/network/268739.Nmlp_2880Family 3 CoA transferase; Gene has an in-frame stop codon and is truncated at the N-terminus; locus_tag: Nmlp_2879A; product: IS1341-type transposase NmIRS31 (nonfunctional).
Nmlp_2882 protein networkhttps://string-db.org/network/268739.Nmlp_2882UPF0324 family protein.
Nmlp_2883 protein networkhttps://string-db.org/network/268739.Nmlp_2883Probable rhomboid family protease.
Nmlp_2884 protein networkhttps://string-db.org/network/268739.Nmlp_2884Probable rRNA methyltransferase.
Nmlp_2885 protein networkhttps://string-db.org/network/268739.Nmlp_2885Uncharacterized protein.
tfbA3 protein networkhttps://string-db.org/network/268739.Nmlp_2886Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).
deoC1 protein networkhttps://string-db.org/network/268739.Nmlp_2887Deoxyribose-phosphate aldolase.
Nmlp_2888 protein networkhttps://string-db.org/network/268739.Nmlp_2888MiaB-like tRNA modifying enzyme.
Nmlp_2889 protein networkhttps://string-db.org/network/268739.Nmlp_2889Transport protein (probable substrate zinc/cadmium/cobalt).
hit1 protein networkhttps://string-db.org/network/268739.Nmlp_2890Histidine triad family protein (homolog to bis(5'-nucleosyl)-tetraphosphatase).
Nmlp_2891 protein networkhttps://string-db.org/network/268739.Nmlp_2891Small CPxCG-related zinc finger protein.
fba1 protein networkhttps://string-db.org/network/268739.Nmlp_2892Fructose-bisphosphate aldolase, class 1.
fbp protein networkhttps://string-db.org/network/268739.Nmlp_2893Fructose-1,6-bisphosphatase.
Nmlp_2895 protein networkhttps://string-db.org/network/268739.Nmlp_2895Uncharacterized protein; Gene has a frameshift and is truncated at the C-terminus; locus_tag: Nmlp_2894; product: uncharacterized protein (nonfunctional).
Nmlp_2896 protein networkhttps://string-db.org/network/268739.Nmlp_2896Uncharacterized protein.
Nmlp_2897 protein networkhttps://string-db.org/network/268739.Nmlp_2897DUF460 domain protein.
cbs7 protein networkhttps://string-db.org/network/268739.Nmlp_2898CBS domain protein.
Nmlp_2899 protein networkhttps://string-db.org/network/268739.Nmlp_2899UspA domain protein.
Nmlp_2900 protein networkhttps://string-db.org/network/268739.Nmlp_2900UspA domain protein.
mscS1 protein networkhttps://string-db.org/network/268739.Nmlp_2902Mechanosensitive channel protein MscS; Product: UspA domain protein (nonfunctional).
Nmlp_2903 protein networkhttps://string-db.org/network/268739.Nmlp_2903CRM domain protein.
rnp4 protein networkhttps://string-db.org/network/268739.Nmlp_2904Ribonuclease P protein component 4; Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.
Nmlp_2905 protein networkhttps://string-db.org/network/268739.Nmlp_2905Uncharacterized protein.
pdaD protein networkhttps://string-db.org/network/268739.Nmlp_2906Pyruvoyl-dependent arginine decarboxylase.
Nmlp_2907 protein networkhttps://string-db.org/network/268739.Nmlp_2907Homolog to antitoxin VapB.
Nmlp_2912 protein networkhttps://string-db.org/network/268739.Nmlp_2912Homolog to UvrD/REP helicase; Product: uncharacterized protein (nonfunctional).
Nmlp_2913 protein networkhttps://string-db.org/network/268739.Nmlp_2913Uncharacterized protein.
Nmlp_2914 protein networkhttps://string-db.org/network/268739.Nmlp_2914UvrD/REP family helicase.
Nmlp_2918 protein networkhttps://string-db.org/network/268739.Nmlp_2918Gene has been targetted by a transposon; locus_tag: Nmlp_2917; product: IS1341-type transposase ISNamo20 (nonfunctional); conceptual translation after in silico reconstruction: MLEIHRTHRAKILNHNQV [...]
Nmlp_2920 protein networkhttps://string-db.org/network/268739.Nmlp_2920AAA-type ATPase domain protein; Product: ISH14-type transposase NmIRS20 (nonfunctional).
Nmlp_2921 protein networkhttps://string-db.org/network/268739.Nmlp_2921Uncharacterized protein.
Nmlp_2922 protein networkhttps://string-db.org/network/268739.Nmlp_2922Uncharacterized protein.
Nmlp_2923 protein networkhttps://string-db.org/network/268739.Nmlp_2923Adenine-specific DNA modification methylase.
Nmlp_2924 protein networkhttps://string-db.org/network/268739.Nmlp_2924DUF2204 family protein.
Nmlp_2925 protein networkhttps://string-db.org/network/268739.Nmlp_2925ArsR family transcription regulator.
Nmlp_2926 protein networkhttps://string-db.org/network/268739.Nmlp_2926DUF499 domain protein.
Nmlp_2927 protein networkhttps://string-db.org/network/268739.Nmlp_2927ATP-dependent helicase.
Nmlp_2928 protein networkhttps://string-db.org/network/268739.Nmlp_2928Uncharacterized protein.
Nmlp_2929 protein networkhttps://string-db.org/network/268739.Nmlp_2929XerC/D-like integrase.
Nmlp_2930 protein networkhttps://string-db.org/network/268739.Nmlp_2930Uncharacterized protein.
Nmlp_2934 protein networkhttps://string-db.org/network/268739.Nmlp_2934ISH18-type transposase NmIRS12; Gene is truncated at the C-terminus; product: ISH11-type transposase NmIRS11 (nonfunctional).
Nmlp_2935 protein networkhttps://string-db.org/network/268739.Nmlp_2935Coiled-coil protein.
ftsZ6 protein networkhttps://string-db.org/network/268739.Nmlp_2936FtsZ family protein, noncanonical.
Nmlp_2939 protein networkhttps://string-db.org/network/268739.Nmlp_2939Uncharacterized protein.
ftsZ7 protein networkhttps://string-db.org/network/268739.Nmlp_2940FtsZ family protein, noncanonical.
CCQ37088.1 protein networkhttps://string-db.org/network/268739.Nmlp_2940AUncharacterized protein.
Nmlp_2941 protein networkhttps://string-db.org/network/268739.Nmlp_2941Coiled-coil protein.
ftsZ8 protein networkhttps://string-db.org/network/268739.Nmlp_2945FtsZ family protein, noncanonical.
Nmlp_2946 protein networkhttps://string-db.org/network/268739.Nmlp_2946Uncharacterized protein.
Nmlp_2948 protein networkhttps://string-db.org/network/268739.Nmlp_2948Uncharacterized protein.
Nmlp_2949 protein networkhttps://string-db.org/network/268739.Nmlp_2949Probable secreted glycoprotein.
Nmlp_2950 protein networkhttps://string-db.org/network/268739.Nmlp_2950PQQ repeat protein.
Nmlp_2951 protein networkhttps://string-db.org/network/268739.Nmlp_2951AAA-type ATPase core domain protein; Belongs to the AAA ATPase family.
CCQ37096.1 protein networkhttps://string-db.org/network/268739.Nmlp_2951AUncharacterized protein.
Nmlp_2952 protein networkhttps://string-db.org/network/268739.Nmlp_2952Uncharacterized protein.
Nmlp_2953 protein networkhttps://string-db.org/network/268739.Nmlp_2953Uncharacterized protein.
ubiA2 protein networkhttps://string-db.org/network/268739.Nmlp_2958tRNA-Arg; Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C2 hydroxyl of (S)-3-O-geranylgeranylglyceryl phosphate (GGGP). Th [...]
Nmlp_2959 protein networkhttps://string-db.org/network/268739.Nmlp_2959YneT family protein.
Nmlp_2960 protein networkhttps://string-db.org/network/268739.Nmlp_2960Uncharacterized protein.
lpl2 protein networkhttps://string-db.org/network/268739.Nmlp_2961Lipoate-protein ligase domain protein.
Nmlp_2965 protein networkhttps://string-db.org/network/268739.Nmlp_2965Receiver box response regulator.
Nmlp_2966 protein networkhttps://string-db.org/network/268739.Nmlp_2966Receiver box HTH-10 family transcription regulator.
Nmlp_2967 protein networkhttps://string-db.org/network/268739.Nmlp_2967Sensor box histidine kinase.
Nmlp_2968 protein networkhttps://string-db.org/network/268739.Nmlp_2968HTH domain protein.
thrC3 protein networkhttps://string-db.org/network/268739.Nmlp_2969Threonine synthase.
htr34 protein networkhttps://string-db.org/network/268739.Nmlp_2970Transducer protein Htr34.
Nmlp_2971 protein networkhttps://string-db.org/network/268739.Nmlp_2971Uncharacterized protein.
Nmlp_2972 protein networkhttps://string-db.org/network/268739.Nmlp_2972Amine oxidase domain protein.
Nmlp_2973 protein networkhttps://string-db.org/network/268739.Nmlp_2973Cupin 2 barrel domain protein.
Nmlp_2974 protein networkhttps://string-db.org/network/268739.Nmlp_2974Probable phosphoesterase.
Nmlp_2975 protein networkhttps://string-db.org/network/268739.Nmlp_2975arNOG05395 family transcription regulator.
dapB protein networkhttps://string-db.org/network/268739.Nmlp_29764-hydroxy-tetrahydrodipicolinate reductase; Catalyzes the conversion of 4-hydroxy-tetrahydrodipicolinate (HTPA) to tetrahydrodipicolinate; Belongs to the DapB family.
dapA protein networkhttps://string-db.org/network/268739.Nmlp_29774-hydroxy-tetrahydrodipicolinate synthase; Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA).
Nmlp_2978 protein networkhttps://string-db.org/network/268739.Nmlp_2978TrkA-N domain protein.
Nmlp_2979 protein networkhttps://string-db.org/network/268739.Nmlp_2979Uncharacterized protein.
Nmlp_2980 protein networkhttps://string-db.org/network/268739.Nmlp_2980Uncharacterized protein.
Nmlp_2981 protein networkhttps://string-db.org/network/268739.Nmlp_2981NurA domain protein.
icd protein networkhttps://string-db.org/network/268739.Nmlp_2982Isocitrate dehydrogenase (NADP).
proS protein networkhttps://string-db.org/network/268739.Nmlp_2983proline--tRNA ligase; Catalyzes the attachment of proline to tRNA(Pro) in a two- step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRNA( [...]
Nmlp_2984 protein networkhttps://string-db.org/network/268739.Nmlp_2984Homolog to sulfate adenylyltransferase small subunit.
Nmlp_2985 protein networkhttps://string-db.org/network/268739.Nmlp_2985Uncharacterized protein.
Nmlp_2986 protein networkhttps://string-db.org/network/268739.Nmlp_2986Uncharacterized protein.
gltB protein networkhttps://string-db.org/network/268739.Nmlp_2987Glutamate synthase large subunit.
gcvH protein networkhttps://string-db.org/network/268739.Nmlp_2988Glycine cleavage system protein H; The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.
Nmlp_2989 protein networkhttps://string-db.org/network/268739.Nmlp_2989DUF88 family protein.
Nmlp_2990 protein networkhttps://string-db.org/network/268739.Nmlp_2990Homolog to sodium/calcium antiporter.
Nmlp_2991 protein networkhttps://string-db.org/network/268739.Nmlp_2991Probable S-adenosylmethionine-dependent methyltransferase.
mpcT protein networkhttps://string-db.org/network/268739.Nmlp_2992Transducer protein MpcT.
lysA protein networkhttps://string-db.org/network/268739.Nmlp_2993Diaminopimelate decarboxylase; Specifically catalyzes the decarboxylation of meso- diaminopimelate (meso-DAP) to L-lysine.
deoC2 protein networkhttps://string-db.org/network/268739.Nmlp_2994Deoxyribose-phosphate aldolase; Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5- phosphate; Belongs to the DeoC/FbaB ald [...]
Nmlp_2995 protein networkhttps://string-db.org/network/268739.Nmlp_2995DUF4010 family protein.
purB protein networkhttps://string-db.org/network/268739.Nmlp_2996Adenylosuccinate lyase.
Nmlp_2997 protein networkhttps://string-db.org/network/268739.Nmlp_2997HAD superfamily hydrolase.
Nmlp_2998 protein networkhttps://string-db.org/network/268739.Nmlp_2998APH family phosphotransferase.
purNH protein networkhttps://string-db.org/network/268739.Nmlp_2999Phosphoribosylglycinamide formyltransferase / phosphoribosylaminoimidazolecarboxamide formyltransferase.
Tif2Ba protein networkhttps://string-db.org/network/268739.Nmlp_3000NUDIX family hydrolase / eIF-2B domain protein; Belongs to the eIF-2B alpha/beta/delta subunits family.
aglM protein networkhttps://string-db.org/network/268739.Nmlp_3001UDP-glucose 6-dehydrogenase AglM.
trmY protein networkhttps://string-db.org/network/268739.Nmlp_3002tRNA (pseudouridine(54)-N(1))-methyltransferase; Specifically catalyzes the N1-methylation of pseudouridine at position 54 (Psi54) in tRNAs; Belongs to the methyltransferase superfamily. TrmY fam [...]
Nmlp_3003 protein networkhttps://string-db.org/network/268739.Nmlp_3003Uncharacterized protein.
Nmlp_3004 protein networkhttps://string-db.org/network/268739.Nmlp_3004Small CPxCG-related zinc finger protein.
Nmlp_3005 protein networkhttps://string-db.org/network/268739.Nmlp_3005arNOG05179 family protein (DUF87-related AAA-type ATPase).
Nmlp_3006 protein networkhttps://string-db.org/network/268739.Nmlp_3006Uncharacterized protein; Product: IS1341-type transposase NmIRS61 (nonfunctional).
pyrB protein networkhttps://string-db.org/network/268739.Nmlp_3007Aspartate carbamoyltransferase catalytic subunit.
pyrI protein networkhttps://string-db.org/network/268739.Nmlp_3008Aspartate carbamoyltransferase regulatory subunit; Involved in allosteric regulation of aspartate carbamoyltransferase.
Nmlp_3009 protein networkhttps://string-db.org/network/268739.Nmlp_3009Glycoside hydrolase domain protein.
Nmlp_3010 protein networkhttps://string-db.org/network/268739.Nmlp_3010NUDIX family hydrolase.
Nmlp_3011 protein networkhttps://string-db.org/network/268739.Nmlp_3011DUF1918 family protein.
Nmlp_3012 protein networkhttps://string-db.org/network/268739.Nmlp_3012DUF54 family protein.
Nmlp_3013 protein networkhttps://string-db.org/network/268739.Nmlp_3013Uncharacterized protein.
cyc2 protein networkhttps://string-db.org/network/268739.Nmlp_3014Cytochrome P450.
Nmlp_3015 protein networkhttps://string-db.org/network/268739.Nmlp_3015Uncharacterized protein.
rad25c protein networkhttps://string-db.org/network/268739.Nmlp_3016DNA repair helicase Rad25.
yvoF protein networkhttps://string-db.org/network/268739.Nmlp_3017O-acetyltransferase (homolog to galactoside O-acetyltransferase).
Nmlp_3018 protein networkhttps://string-db.org/network/268739.Nmlp_3018Uncharacterized protein.
mscS2 protein networkhttps://string-db.org/network/268739.Nmlp_3019Mechanosensitive channel protein MscS.
dacZ protein networkhttps://string-db.org/network/268739.Nmlp_3020DisA-N domain protein; Diadenylate cyclase that catalyzes the condensation of 2 ATP molecules into cyclic di-AMP (c-di-AMP). c-di-AMP is a second messenger for intracellular signal transduction i [...]
nthA protein networkhttps://string-db.org/network/268739.Nmlp_3021Endonuclease 3; DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N-gl [...]
Nmlp_3022 protein networkhttps://string-db.org/network/268739.Nmlp_3022NUDIX family hydrolase.
Nmlp_3023 protein networkhttps://string-db.org/network/268739.Nmlp_3023Uncharacterized protein.
sph2 protein networkhttps://string-db.org/network/268739.Nmlp_3024Smc-like protein Sph2.
Nmlp_3025 protein networkhttps://string-db.org/network/268739.Nmlp_3025Probable oxidoreductase (short-chain dehydrogenase family).
crtD protein networkhttps://string-db.org/network/268739.Nmlp_3026Carotenoid 3,4-desaturase.
lyeJ protein networkhttps://string-db.org/network/268739.Nmlp_3027Lycopene elongase / lycopene 1,2-hydratase.
cruF protein networkhttps://string-db.org/network/268739.Nmlp_3028Bisanhydrobacterioruberin hydratase.
crtB protein networkhttps://string-db.org/network/268739.Nmlp_3029Phytoene synthase.
rnhA1 protein networkhttps://string-db.org/network/268739.Nmlp_3030Ribonuclease H, type 1.
radB protein networkhttps://string-db.org/network/268739.Nmlp_3031DNA repair and recombination protein RadB; Involved in DNA repair and in homologous recombination. May regulate the cleavage reactions of the branch-structured DNA. Has a very weak ATPase activit [...]
Nmlp_3032 protein networkhttps://string-db.org/network/268739.Nmlp_3032Uncharacterized protein.
Nmlp_3033 protein networkhttps://string-db.org/network/268739.Nmlp_3033Purine nucleoside permease domain protein.
rps8e protein networkhttps://string-db.org/network/268739.Nmlp_303430S ribosomal protein S8e.
cmk1 protein networkhttps://string-db.org/network/268739.Nmlp_3035Cytidylate kinase.
Nmlp_3036 protein networkhttps://string-db.org/network/268739.Nmlp_3036Uncharacterized protein.
entB1 protein networkhttps://string-db.org/network/268739.Nmlp_3037Isochorismatase family protein.
Nmlp_3038 protein networkhttps://string-db.org/network/268739.Nmlp_3038YcgG family protein.
Nmlp_3039 protein networkhttps://string-db.org/network/268739.Nmlp_3039Uncharacterized protein.
Nmlp_3040 protein networkhttps://string-db.org/network/268739.Nmlp_3040Histidine kinase.
tatD protein networkhttps://string-db.org/network/268739.Nmlp_30413'-5' ssDNA/RNA exonuclease TatD.
Nmlp_3042 protein networkhttps://string-db.org/network/268739.Nmlp_3042GNAT family acetyltransferase.
Nmlp_3043 protein networkhttps://string-db.org/network/268739.Nmlp_3043YdjM family protein.
Nmlp_3044 protein networkhttps://string-db.org/network/268739.Nmlp_3044YdjM family protein.
Nmlp_3045 protein networkhttps://string-db.org/network/268739.Nmlp_3045cro/C1 family transcription regulator.
Nmlp_3046 protein networkhttps://string-db.org/network/268739.Nmlp_3046Probable oxidoreductase (aldo-keto reductase family protein).
pduO protein networkhttps://string-db.org/network/268739.Nmlp_3047ATP:cob(I)alamin adenosyltransferase.
Nmlp_3048 protein networkhttps://string-db.org/network/268739.Nmlp_3048FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase).
Nmlp_3049 protein networkhttps://string-db.org/network/268739.Nmlp_3049Product: uncharacterized protein (nonfunctional).
Nmlp_3050 protein networkhttps://string-db.org/network/268739.Nmlp_3050FAD-dependent oxidoreductase (GlcD/DLD_GlcF/GlpC domain fusion protein).
Nmlp_3051 protein networkhttps://string-db.org/network/268739.Nmlp_3051Uncharacterized protein.
Nmlp_3052 protein networkhttps://string-db.org/network/268739.Nmlp_3052Uncharacterized protein.
Nmlp_3053 protein networkhttps://string-db.org/network/268739.Nmlp_3053Uncharacterized protein.
rpl1 protein networkhttps://string-db.org/network/268739.Nmlp_305450S ribosomal protein L1; Binds directly to 23S rRNA. Probably involved in E site tRNA release.
rpl10 protein networkhttps://string-db.org/network/268739.Nmlp_305550S ribosomal protein L10; Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors. Belongs to the universal ribosomal prot [...]
rpl12 protein networkhttps://string-db.org/network/268739.Nmlp_305650S ribosomal protein L12; Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors. Belongs to the eukaryotic ribosomal pro [...]
Nmlp_3057 protein networkhttps://string-db.org/network/268739.Nmlp_3057DUF112 family protein.
cysS protein networkhttps://string-db.org/network/268739.Nmlp_3058cysteine--tRNA ligase.
Nmlp_3059 protein networkhttps://string-db.org/network/268739.Nmlp_3059Uncharacterized protein.
cbiX2 protein networkhttps://string-db.org/network/268739.Nmlp_3060Sirohydrochlorin cobaltochelatase.
Nmlp_3061 protein networkhttps://string-db.org/network/268739.Nmlp_3061Uncharacterized protein.
Nmlp_3062 protein networkhttps://string-db.org/network/268739.Nmlp_3062Uncharacterized protein.
Nmlp_3063 protein networkhttps://string-db.org/network/268739.Nmlp_3063UPF0434 family protein.
Nmlp_3064 protein networkhttps://string-db.org/network/268739.Nmlp_3064DUF123 domain protein.
Nmlp_3065 protein networkhttps://string-db.org/network/268739.Nmlp_3065DMT superfamily transport protein.
Nmlp_3066 protein networkhttps://string-db.org/network/268739.Nmlp_3066START domain protein.
Nmlp_3067 protein networkhttps://string-db.org/network/268739.Nmlp_3067Lrp/AsnC family transcription regulator.
rpc34 protein networkhttps://string-db.org/network/268739.Nmlp_3068Probable transcription factor (homolog to RNA polymerase III subunit RPC34).
Nmlp_3069 protein networkhttps://string-db.org/network/268739.Nmlp_3069NRDE domain protein.
menE protein networkhttps://string-db.org/network/268739.Nmlp_3070o-succinylbenzoate--CoA ligase.
menC protein networkhttps://string-db.org/network/268739.Nmlp_3071O-succinylbenzoate synthase; Converts 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylate (SHCHC) to 2-succinylbenzoate (OSB).
menA protein networkhttps://string-db.org/network/268739.Nmlp_30721,4-dihydroxy-2-naphthoate octaprenyltransferase; Conversion of 1,4-dihydroxy-2-naphthoate (DHNA) to demethylmenaquinone (DMK); Belongs to the MenA family. Type 1 subfamily.
menB protein networkhttps://string-db.org/network/268739.Nmlp_30731,4-dihydroxy-2-naphthoyl-CoA synthase; Converts o-succinylbenzoyl-CoA (OSB-CoA) to 1,4-dihydroxy-2- naphthoyl-CoA (DHNA-CoA); Belongs to the enoyl-CoA hydratase/isomerase family. MenB subfamily.
Nmlp_3075 protein networkhttps://string-db.org/network/268739.Nmlp_3075DUF2892 family protein.
mscS3 protein networkhttps://string-db.org/network/268739.Nmlp_3076Mechanosensitive channel protein MscS.
Nmlp_3077 protein networkhttps://string-db.org/network/268739.Nmlp_3077DUF181 family protein.
Nmlp_3078 protein networkhttps://string-db.org/network/268739.Nmlp_3078Uncharacterized protein.
glyA protein networkhttps://string-db.org/network/268739.Nmlp_3079Serine hydroxymethyltransferase; Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. Also exhibits THF-independent aldola [...]
Nmlp_3080 protein networkhttps://string-db.org/network/268739.Nmlp_3080DoxX domain protein.
Nmlp_3081 protein networkhttps://string-db.org/network/268739.Nmlp_3081Flavin-dependent pyridine nucleotide oxidoreductase (homolog to coenzyme A disulfide reductase).
folD protein networkhttps://string-db.org/network/268739.Nmlp_3082Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase; Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolys [...]
Nmlp_3083 protein networkhttps://string-db.org/network/268739.Nmlp_3083NUDIX family hydrolase.
Nmlp_3084 protein networkhttps://string-db.org/network/268739.Nmlp_3084Uncharacterized protein.
ansB protein networkhttps://string-db.org/network/268739.Nmlp_3085Asparaginase/glutaminase family protein.
Nmlp_3086 protein networkhttps://string-db.org/network/268739.Nmlp_3086Uncharacterized protein.
Nmlp_3087 protein networkhttps://string-db.org/network/268739.Nmlp_3087PadR family transcription regulator.
Nmlp_3088 protein networkhttps://string-db.org/network/268739.Nmlp_3088DUF357 family protein.
trm5 protein networkhttps://string-db.org/network/268739.Nmlp_3089tRNA (guanine(37)-N(1))-methyltransferase.
Nmlp_3090 protein networkhttps://string-db.org/network/268739.Nmlp_3090DUF2298 family protein.
btuD protein networkhttps://string-db.org/network/268739.Nmlp_3091ABC-type transport system ATP-binding protein (probable substrate cobalamin).
btuC protein networkhttps://string-db.org/network/268739.Nmlp_3092ABC-type transport system permease protein (probable substrate cobalamin).
btuF protein networkhttps://string-db.org/network/268739.Nmlp_3093ABC-type transport system periplasmic substrate-binding protein (probable substrate cobalamin).
srp19 protein networkhttps://string-db.org/network/268739.Nmlp_3094Signal recognition particle 19K protein; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kD [...]
gar1 protein networkhttps://string-db.org/network/268739.Nmlp_3095tRNA/rRNA pseudouridine synthase complex protein Gar1.
Nmlp_3096 protein networkhttps://string-db.org/network/268739.Nmlp_3096DUF1119 family protein.
Nmlp_3097 protein networkhttps://string-db.org/network/268739.Nmlp_3097Homolog to ornithine cyclodeaminase.
korB2 protein networkhttps://string-db.org/network/268739.Nmlp_3098Oxoglutarate--ferredoxin oxidoreductase beta subunit.
Nmlp_3099 protein networkhttps://string-db.org/network/268739.Nmlp_3099Uncharacterized protein.
sufB3 protein networkhttps://string-db.org/network/268739.Nmlp_3100SufB domain protein.
Nmlp_3101 protein networkhttps://string-db.org/network/268739.Nmlp_3101Uncharacterized protein; Gene has an insert and is truncated at the N-terminus; product: IS1341-type transposase NmIRS67 (nonfunctional); locus_tag: Nmlp_3100A.
trxB1 protein networkhttps://string-db.org/network/268739.Nmlp_3102Thioredoxin-disulfide reductase.
Nmlp_3103 protein networkhttps://string-db.org/network/268739.Nmlp_3103RND superfamily permease.
Nmlp_3104 protein networkhttps://string-db.org/network/268739.Nmlp_3104Uncharacterized protein.
Nmlp_3106 protein networkhttps://string-db.org/network/268739.Nmlp_3106Uncharacterized protein; Gene has an in-frame stop codon and lacks a start; locus_tag: Nmlp_3105; product: UspA domain protein (nonfunctional); conceptual translation after in silico reconstructi [...]
Nmlp_3107 protein networkhttps://string-db.org/network/268739.Nmlp_3107Uncharacterized protein.
Nmlp_3108 protein networkhttps://string-db.org/network/268739.Nmlp_3108Uncharacterized protein.
Nmlp_3109 protein networkhttps://string-db.org/network/268739.Nmlp_3109Uncharacterized protein.
Nmlp_3110 protein networkhttps://string-db.org/network/268739.Nmlp_3110GTP cyclohydrolase 1 domain protein.
gldA protein networkhttps://string-db.org/network/268739.Nmlp_3111Glycerol-1-phosphate dehydrogenase (NAD(P)); Catalyzes the NAD(P)H-dependent reduction of dihydroxyacetonephosphate (DHAP or glycerone phosphate) to glycerol 1- phosphate (G1P). The G1P thus gene [...]
Nmlp_3112 protein networkhttps://string-db.org/network/268739.Nmlp_3112GalE family epimerase/dehydratase.
cetZ2 protein networkhttps://string-db.org/network/268739.Nmlp_3115Tubulin-like protein CetZ; Involved in cell shape control; Belongs to the CetZ family.
cetZ3 protein networkhttps://string-db.org/network/268739.Nmlp_3116FtsZ family protein CetZ, type III; Involved in cell shape control; Belongs to the CetZ family.
Nmlp_3117 protein networkhttps://string-db.org/network/268739.Nmlp_3117Uncharacterized protein.
Nmlp_3118 protein networkhttps://string-db.org/network/268739.Nmlp_3118Receiver box response regulator.
Nmlp_3119 protein networkhttps://string-db.org/network/268739.Nmlp_3119Sensor/bat box HTH-10 family transcription regulator.
Nmlp_3120 protein networkhttps://string-db.org/network/268739.Nmlp_3120Histidine kinase.
Nmlp_3121 protein networkhttps://string-db.org/network/268739.Nmlp_3121Uncharacterized protein.
Nmlp_3122 protein networkhttps://string-db.org/network/268739.Nmlp_3122ArsR family transcription regulator.
acaB3 protein networkhttps://string-db.org/network/268739.Nmlp_3125acetyl-CoA C-acyltransferase.
Nmlp_3126 protein networkhttps://string-db.org/network/268739.Nmlp_3126DUF35 family protein.
acs1 protein networkhttps://string-db.org/network/268739.Nmlp_3127acyl-CoA synthetase.
Nmlp_3128 protein networkhttps://string-db.org/network/268739.Nmlp_3128TrkA-N domain protein.
Nmlp_3129 protein networkhttps://string-db.org/network/268739.Nmlp_3129Amidohydrolase domain protein.
maoC1 protein networkhttps://string-db.org/network/268739.Nmlp_3130MaoC domain protein.
mmcA1 protein networkhttps://string-db.org/network/268739.Nmlp_3131methylmalonyl-CoA mutase subunit A.
hbd protein networkhttps://string-db.org/network/268739.Nmlp_31323-hydroxyacyl-CoA dehydrogenase.
acd3 protein networkhttps://string-db.org/network/268739.Nmlp_3133acyl-CoA dehydrogenase.
Nmlp_3134 protein networkhttps://string-db.org/network/268739.Nmlp_3134IclR family transcription regulator.
folCP protein networkhttps://string-db.org/network/268739.Nmlp_3136Folylpolyglutamate synthase / 7,8-dihydropteroate reductase / dihydropteroate synthase.
gth3 protein networkhttps://string-db.org/network/268739.Nmlp_3137Probable glycosyltransferase, type 1.
Nmlp_3140 protein networkhttps://string-db.org/network/268739.Nmlp_3140GNAT family acetyltransferase; Product: peptidase S9 family protein (nonfunctional).
Nmlp_3141 protein networkhttps://string-db.org/network/268739.Nmlp_3141Uncharacterized protein.
Nmlp_3142 protein networkhttps://string-db.org/network/268739.Nmlp_3142Receiver/sensor box histidine kinase.
rfcB protein networkhttps://string-db.org/network/268739.Nmlp_3143Replication factor C large subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcL subfamily.
Nmlp_3144 protein networkhttps://string-db.org/network/268739.Nmlp_3144ABC-type transport system ATP-binding protein (probable substrate glutamine/glutamate/polar amino acids).
Nmlp_3145 protein networkhttps://string-db.org/network/268739.Nmlp_3145ABC-type transport system permease protein (probable substrate glutamine/glutamate/polar amino acids).
Nmlp_3146 protein networkhttps://string-db.org/network/268739.Nmlp_3146ABC-type transport system periplasmic substrate-binding protein (probable substrate glutamine/glutamate/polar amino acids).
maeB2 protein networkhttps://string-db.org/network/268739.Nmlp_3147Malate dehydrogenase (oxaloacetate-decarboxylating).
Nmlp_3148 protein networkhttps://string-db.org/network/268739.Nmlp_3148IS1341-type transposase ISNamo20.
ctaA protein networkhttps://string-db.org/network/268739.Nmlp_3149Heme A synthase.
cad protein networkhttps://string-db.org/network/268739.Nmlp_3150Probable pterin-4-alpha-carbinolamine dehydratase.
Nmlp_3151 protein networkhttps://string-db.org/network/268739.Nmlp_3151Uncharacterized protein.
Nmlp_3152 protein networkhttps://string-db.org/network/268739.Nmlp_3152DUF2240 family protein.
Nmlp_3153 protein networkhttps://string-db.org/network/268739.Nmlp_3153Uncharacterized protein.
Nmlp_3154 protein networkhttps://string-db.org/network/268739.Nmlp_3154HAD superfamily hydrolase.
pyrF protein networkhttps://string-db.org/network/268739.Nmlp_3155Orotidine-5'-phosphate decarboxylase; Belongs to the OMP decarboxylase family. Type 2 subfamily.
Nmlp_3156 protein networkhttps://string-db.org/network/268739.Nmlp_3156NP_1176A family transcription regulator.
Nmlp_3157 protein networkhttps://string-db.org/network/268739.Nmlp_3157ISHwa16-type transposase ISNamo15.
Nmlp_3159 protein networkhttps://string-db.org/network/268739.Nmlp_3159Uncharacterized protein.
cheC2 protein networkhttps://string-db.org/network/268739.Nmlp_3160Taxis cluster protein CheC.
cysK protein networkhttps://string-db.org/network/268739.Nmlp_3161Cysteine synthase.
Nmlp_3162 protein networkhttps://string-db.org/network/268739.Nmlp_3162PaaY family protein.
Nmlp_3163 protein networkhttps://string-db.org/network/268739.Nmlp_3163Receiver box response regulator.
leuA1 protein networkhttps://string-db.org/network/268739.Nmlp_3165Uncharacterized protein; Product: 2-isopropylmalate synthase (nonfunctional).
ilvB protein networkhttps://string-db.org/network/268739.Nmlp_3166Acetolactate synthase large subunit.
ilvN protein networkhttps://string-db.org/network/268739.Nmlp_3167Acetolactate synthase small subunit.
ilvC protein networkhttps://string-db.org/network/268739.Nmlp_3168Ketol-acid reductoisomerase; Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yie [...]
Nmlp_3169 protein networkhttps://string-db.org/network/268739.Nmlp_3169Uncharacterized protein.
leuC protein networkhttps://string-db.org/network/268739.Nmlp_31703-isopropylmalate dehydratase large subunit; Catalyzes the isomerization between 2-isopropylmalate and 3- isopropylmalate, via the formation of 2-isopropylmaleate.
leuD protein networkhttps://string-db.org/network/268739.Nmlp_31713-isopropylmalate dehydratase small subunit.
leuB protein networkhttps://string-db.org/network/268739.Nmlp_31723-isopropylmalate dehydrogenase.
Nmlp_3173 protein networkhttps://string-db.org/network/268739.Nmlp_3173Uncharacterized protein.
Nmlp_3174 protein networkhttps://string-db.org/network/268739.Nmlp_3174OsmC domain protein.
Nmlp_3175 protein networkhttps://string-db.org/network/268739.Nmlp_3175Metal-dependent hydrolase domain protein; Belongs to the UPF0173 family.
Nmlp_3176 protein networkhttps://string-db.org/network/268739.Nmlp_3176GNAT family acetyltransferase.
Nmlp_3177 protein networkhttps://string-db.org/network/268739.Nmlp_3177Fumarylacetoacetase family protein.
Nmlp_3178 protein networkhttps://string-db.org/network/268739.Nmlp_3178Uncharacterized protein.
mobA1 protein networkhttps://string-db.org/network/268739.Nmlp_3179Molybdenum cofactor guanylyltransferase; Transfers a GMP moiety from GTP to Mo-molybdopterin (Mo-MPT) cofactor (Moco or molybdenum cofactor) to form Mo-molybdopterin guanine dinucleotide (Mo-MGD) [...]
hisC protein networkhttps://string-db.org/network/268739.Nmlp_3180Histidinol-phosphate aminotransferase.
adk2 protein networkhttps://string-db.org/network/268739.Nmlp_3181Probable adenylate kinase; Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and mono [...]
agsA protein networkhttps://string-db.org/network/268739.Nmlp_3182Probable archaetidylglycerolphosphate synthase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
Nmlp_3183 protein networkhttps://string-db.org/network/268739.Nmlp_3183cro/C1 family transcription regulator.
Nmlp_3184 protein networkhttps://string-db.org/network/268739.Nmlp_3184Uncharacterized protein.
Nmlp_3185 protein networkhttps://string-db.org/network/268739.Nmlp_3185Uncharacterized protein.
flaCE protein networkhttps://string-db.org/network/268739.Nmlp_3186Fla cluster protein FlaCE.
flaH protein networkhttps://string-db.org/network/268739.Nmlp_3187Fla cluster protein FlaH.
flaI protein networkhttps://string-db.org/network/268739.Nmlp_3188Flagellar motor/biogenesis protein FlaI.
flaJ protein networkhttps://string-db.org/network/268739.Nmlp_3189Flagellar motor/biogenesis protein FlaJ.
cheF2 protein networkhttps://string-db.org/network/268739.Nmlp_3190Taxis protein CheF2.
rpe protein networkhttps://string-db.org/network/268739.Nmlp_3191Rpa-associated phosphoesterase.
rpap1 protein networkhttps://string-db.org/network/268739.Nmlp_3192Rpa-associated protein.
rpa1 protein networkhttps://string-db.org/network/268739.Nmlp_3193Replication protein A.
Nmlp_3194 protein networkhttps://string-db.org/network/268739.Nmlp_3194Probable DEAD/DEAH box helicase.
Nmlp_3195 protein networkhttps://string-db.org/network/268739.Nmlp_3195Ribonuclease H domain protein.
trxA5 protein networkhttps://string-db.org/network/268739.Nmlp_3196Thioredoxin.
cheD protein networkhttps://string-db.org/network/268739.Nmlp_3197Taxis cluster protein CheD; Probably deamidates glutamine residues to glutamate on methyl-accepting chemotaxis receptors (MCPs), playing an important role in chemotaxis; Belongs to the CheD famil [...]
cheC1 protein networkhttps://string-db.org/network/268739.Nmlp_3198Taxis cluster protein CheC.
cheY1 protein networkhttps://string-db.org/network/268739.Nmlp_3199Response regulator CheY.
Nmlp_3200 protein networkhttps://string-db.org/network/268739.Nmlp_3200Uncharacterized protein.
flaG2 protein networkhttps://string-db.org/network/268739.Nmlp_3201Fla cluster protein FlaG.
flaG1 protein networkhttps://string-db.org/network/268739.Nmlp_3202Fla cluster protein FlaG.
flaF protein networkhttps://string-db.org/network/268739.Nmlp_3203Fla cluster protein FlaF.
Nmlp_3204 protein networkhttps://string-db.org/network/268739.Nmlp_3204DUF217 family protein.
Nmlp_3205 protein networkhttps://string-db.org/network/268739.Nmlp_3205HTH domain protein.
flg3 protein networkhttps://string-db.org/network/268739.Nmlp_3208Flagellin; Flagellin is the subunit protein which polymerizes to form the filaments of archaeal flagella.
flg2 protein networkhttps://string-db.org/network/268739.Nmlp_3209Flagellin; Flagellin is the subunit protein which polymerizes to form the filaments of archaeal flagella.
flg1 protein networkhttps://string-db.org/network/268739.Nmlp_3210Flagellin; Flagellin is the subunit protein which polymerizes to form the filaments of archaeal flagella.
dpsA2 protein networkhttps://string-db.org/network/268739.Nmlp_3211ferritin/Dps domain protein.
ccdA protein networkhttps://string-db.org/network/268739.Nmlp_3212Cytochrome c-type biogenesis protein CcdA.
Nmlp_3213 protein networkhttps://string-db.org/network/268739.Nmlp_3213Cytochrome c family protein.
Nmlp_3214 protein networkhttps://string-db.org/network/268739.Nmlp_3214Thioredoxin domain protein.
ccmF2 protein networkhttps://string-db.org/network/268739.Nmlp_3215Cytochrome c-type biogenesis protein CcmF.
Nmlp_3216 protein networkhttps://string-db.org/network/268739.Nmlp_3216Uncharacterized protein.
phr4 protein networkhttps://string-db.org/network/268739.Nmlp_3217Cryptochrome/photolyase-related protein.
hcp1 protein networkhttps://string-db.org/network/268739.Nmlp_3218Halocyanin.
Nmlp_3219 protein networkhttps://string-db.org/network/268739.Nmlp_3219uracil-DNA glycosylase superfamily protein.
Nmlp_3220 protein networkhttps://string-db.org/network/268739.Nmlp_3220Uncharacterized protein.
crcB1 protein networkhttps://string-db.org/network/268739.Nmlp_3221Putative fluoride ion transport protein CrcB; Important for reducing fluoride concentration in the cell, thus reducing its toxicity; Belongs to the CrcB (TC 9.B.71) family.
crcB2 protein networkhttps://string-db.org/network/268739.Nmlp_3222Putative fluoride ion transport protein CrcB; Important for reducing fluoride concentration in the cell, thus reducing its toxicity; Belongs to the CrcB (TC 9.B.71) family.
Nmlp_3223 protein networkhttps://string-db.org/network/268739.Nmlp_3223Receiver box response regulator.
rpl40e protein networkhttps://string-db.org/network/268739.Nmlp_322450S ribosomal protein L40e; Belongs to the eukaryotic ribosomal protein eL40 family.
srp54 protein networkhttps://string-db.org/network/268739.Nmlp_3225Signal recognition particle 54K protein; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-n [...]
Nmlp_3226 protein networkhttps://string-db.org/network/268739.Nmlp_3226Receiver box response regulator.
Nmlp_3227 protein networkhttps://string-db.org/network/268739.Nmlp_3227Uncharacterized protein.
Nmlp_3228 protein networkhttps://string-db.org/network/268739.Nmlp_3228ABC-type transport system ATP-binding protein (probable substrate macrolides).
Nmlp_3229 protein networkhttps://string-db.org/network/268739.Nmlp_3229ABC-type transport system permease protein (probable substrate macrolides).
birA protein networkhttps://string-db.org/network/268739.Nmlp_3230HTH domain protein / biotin--[acetyl-CoA-carboxylase] ligase.
Nmlp_3231 protein networkhttps://string-db.org/network/268739.Nmlp_3231UspA domain protein.
GuaD2 protein networkhttps://string-db.org/network/268739.Nmlp_3232Amidohydrolase domain protein.
gptA protein networkhttps://string-db.org/network/268739.Nmlp_3234Probable phosphoribosyltransferase; Product: IS1341-type transposase NmIRS73 (nonfunctional).
qor3 protein networkhttps://string-db.org/network/268739.Nmlp_3235NADPH:quinone reductase.
phzF protein networkhttps://string-db.org/network/268739.Nmlp_3236PhzF family protein.
ppsA protein networkhttps://string-db.org/network/268739.Nmlp_3237Phosphoenolpyruvate synthase; Catalyzes the phosphorylation of pyruvate to phosphoenolpyruvate; Belongs to the PEP-utilizing enzyme family.
panD protein networkhttps://string-db.org/network/268739.Nmlp_3238Aspartate 1-decarboxylase; Catalyzes the decarboxylation of L-aspartate to produce beta- alanine; Belongs to the group II decarboxylase family. MfnA subfamily.
metS protein networkhttps://string-db.org/network/268739.Nmlp_3239methionine--tRNA ligase; Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation.
Nmlp_3240 protein networkhttps://string-db.org/network/268739.Nmlp_3240Uncharacterized protein.
Nmlp_3241 protein networkhttps://string-db.org/network/268739.Nmlp_3241NfeD domain protein.
Nmlp_3242 protein networkhttps://string-db.org/network/268739.Nmlp_3242Probable oxidoreductase (short-chain dehydrogenase family); Belongs to the short-chain dehydrogenases/reductases (SDR) family.
ths3 protein networkhttps://string-db.org/network/268739.Nmlp_3245Thermosome subunit 3; Belongs to the TCP-1 chaperonin family.
gtl4 protein networkhttps://string-db.org/network/268739.Nmlp_3246Probable glycosyltransferase, type 2.
Nmlp_3247 protein networkhttps://string-db.org/network/268739.Nmlp_3247Probable S-adenosylmethionine-dependent methyltransferase.
Nmlp_3248 protein networkhttps://string-db.org/network/268739.Nmlp_3248NP_1176A family transcription regulator.
pncB protein networkhttps://string-db.org/network/268739.Nmlp_3249Nicotinate phosphoribosyltransferase.
rio1 protein networkhttps://string-db.org/network/268739.Nmlp_3250RIO-type serine/threonine protein kinase Rio1.
citZ protein networkhttps://string-db.org/network/268739.Nmlp_3251Citrate synthase.
Nmlp_3252 protein networkhttps://string-db.org/network/268739.Nmlp_3252AstE domain protein.
tiaS protein networkhttps://string-db.org/network/268739.Nmlp_3253tRNA(Ile2) 2-agmatinylcytidine synthetase TiaS; ATP-dependent agmatine transferase that catalyzes the formation of 2-agmatinylcytidine (agm2C) at the wobble position (C34) of tRNA(Ile2), converti [...]
Nmlp_3254 protein networkhttps://string-db.org/network/268739.Nmlp_3254cro/C1 family transcription regulator.
Nmlp_3255 protein networkhttps://string-db.org/network/268739.Nmlp_3255Uncharacterized protein.
Nmlp_3256 protein networkhttps://string-db.org/network/268739.Nmlp_3256AAA-type ATPase (MoxR subfamily).
Nmlp_3257 protein networkhttps://string-db.org/network/268739.Nmlp_3257Uncharacterized protein.
Nmlp_3258 protein networkhttps://string-db.org/network/268739.Nmlp_3258Uncharacterized protein.
Nmlp_3259 protein networkhttps://string-db.org/network/268739.Nmlp_3259Von Willebrand factor type A domain protein.
Nmlp_3260 protein networkhttps://string-db.org/network/268739.Nmlp_3260Uncharacterized protein.
sod protein networkhttps://string-db.org/network/268739.Nmlp_3261Superoxide dismutase (Mn); Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Belongs to the iron/manganese superoxide dismutase family.
Nmlp_3262 protein networkhttps://string-db.org/network/268739.Nmlp_3262Uncharacterized protein.
phr2 protein networkhttps://string-db.org/network/268739.Nmlp_3263Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family.
porB protein networkhttps://string-db.org/network/268739.Nmlp_3264Pyruvate--ferredoxin oxidoreductase beta subunit.
porA protein networkhttps://string-db.org/network/268739.Nmlp_3265Pyruvate--ferredoxin oxidoreductase alpha subunit.
Nmlp_3266 protein networkhttps://string-db.org/network/268739.Nmlp_3266Oxidoreductase (homolog to zinc-containing alcohol dehydrogenase).
Nmlp_3267 protein networkhttps://string-db.org/network/268739.Nmlp_3267DICT domain protein.
ahbB protein networkhttps://string-db.org/network/268739.Nmlp_3268Siroheme decarboxylase AhbB.
sirC protein networkhttps://string-db.org/network/268739.Nmlp_3269Precorrin-2 oxidase / ferrochelatase.
hemA protein networkhttps://string-db.org/network/268739.Nmlp_3270glutamyl-tRNA reductase; Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
cbs1 protein networkhttps://string-db.org/network/268739.Nmlp_3271CBS domain protein.
carB protein networkhttps://string-db.org/network/268739.Nmlp_3272Carbamoyl-phosphate synthase (glutamine-hydrolyzing) large subunit; Belongs to the CarB family.
Nmlp_3273 protein networkhttps://string-db.org/network/268739.Nmlp_3273Sensor box histidine kinase.
Nmlp_3274 protein networkhttps://string-db.org/network/268739.Nmlp_3274Cupin 2 barrel domain protein.
CinA2 protein networkhttps://string-db.org/network/268739.Nmlp_3275ADP-ribose pyrophosphatase.
Nmlp_3276 protein networkhttps://string-db.org/network/268739.Nmlp_3276Uncharacterized protein.
Nmlp_3277 protein networkhttps://string-db.org/network/268739.Nmlp_3277Uncharacterized protein.
hisI protein networkhttps://string-db.org/network/268739.Nmlp_3279phosphoribosyl-AMP cyclohydrolase; Catalyzes the hydrolysis of the adenine ring of phosphoribosyl-AMP.
Nmlp_3280 protein networkhttps://string-db.org/network/268739.Nmlp_3280Uncharacterized protein.
pmm1 protein networkhttps://string-db.org/network/268739.Nmlp_3281Phosphohexomutase (phosphoglucomutase / phosphomannomutase); Belongs to the phosphohexose mutase family.
Nmlp_3282 protein networkhttps://string-db.org/network/268739.Nmlp_3282Uncharacterized protein.
Nmlp_3283 protein networkhttps://string-db.org/network/268739.Nmlp_3283Uncharacterized protein.
polY1 protein networkhttps://string-db.org/network/268739.Nmlp_3284DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismat [...]
Nmlp_3285 protein networkhttps://string-db.org/network/268739.Nmlp_3285DUF87 domain protein.
tpiA protein networkhttps://string-db.org/network/268739.Nmlp_3286Triosephosphate isomerase; Involved in the gluconeogenesis. Catalyzes stereospecifically the conversion of dihydroxyacetone phosphate (DHAP) to D- glyceraldehyde-3-phosphate (G3P); Belongs to the [...]
Nmlp_3287 protein networkhttps://string-db.org/network/268739.Nmlp_3287Uncharacterized protein.
Nmlp_3288 protein networkhttps://string-db.org/network/268739.Nmlp_3288PQQ repeat protein.
Nmlp_3290 protein networkhttps://string-db.org/network/268739.Nmlp_3290DUF1628 domain protein.
ferA5 protein networkhttps://string-db.org/network/268739.Nmlp_3291Ferredoxin (2Fe-2S).
Nmlp_3292 protein networkhttps://string-db.org/network/268739.Nmlp_3292UspA domain protein.
Nmlp_3293 protein networkhttps://string-db.org/network/268739.Nmlp_3293Small CPxCG-related zinc finger protein.
Nmlp_3294 protein networkhttps://string-db.org/network/268739.Nmlp_3294Uncharacterized protein.
Nmlp_3295 protein networkhttps://string-db.org/network/268739.Nmlp_3295Uncharacterized protein.
guaB1 protein networkhttps://string-db.org/network/268739.Nmlp_3297Inosine-5'-monophosphate dehydrogenase; Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesi [...]
Nmlp_3298 protein networkhttps://string-db.org/network/268739.Nmlp_3298Uncharacterized protein.
Nmlp_3299 protein networkhttps://string-db.org/network/268739.Nmlp_3299Putative AhpD family alkylhydroperoxidase.
Nmlp_3300 protein networkhttps://string-db.org/network/268739.Nmlp_3300Uncharacterized protein.
katG protein networkhttps://string-db.org/network/268739.Nmlp_3301Catalase-peroxidase; Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity; Belongs to the peroxidase family. Peroxidase/catalase subfamily.
thrB protein networkhttps://string-db.org/network/268739.Nmlp_3303Homoserine kinase; Catalyzes the ATP-dependent phosphorylation of L-homoserine to L-homoserine phosphate; Belongs to the GHMP kinase family. Homoserine kinase subfamily.
sucD protein networkhttps://string-db.org/network/268739.Nmlp_3304succinate--CoA ligase (ADP-forming) alpha subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP [...]
sucC protein networkhttps://string-db.org/network/268739.Nmlp_3305succinate--CoA ligase (ADP-forming) beta subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP a [...]
pccB protein networkhttps://string-db.org/network/268739.Nmlp_3307propionyl-CoA carboxylase carboxyltransferase component.
pccX protein networkhttps://string-db.org/network/268739.Nmlp_3308propionyl-CoA carboxylase small subunit.
pccA protein networkhttps://string-db.org/network/268739.Nmlp_3309propionyl-CoA carboxylase biotin carboxylase component.
purO protein networkhttps://string-db.org/network/268739.Nmlp_3310Inosine-5'-monophosphate cyclohydrolase,archaeal-type; Catalyzes the cyclization of 5-formylamidoimidazole-4- carboxamide ribonucleotide to IMP.
Nmlp_3311 protein networkhttps://string-db.org/network/268739.Nmlp_3311Uncharacterized protein.
Nmlp_3313 protein networkhttps://string-db.org/network/268739.Nmlp_3313DUF35 family protein.
acaB2 protein networkhttps://string-db.org/network/268739.Nmlp_3314acetyl-CoA C-acetyltransferase.
cadA protein networkhttps://string-db.org/network/268739.Nmlp_3315P-type transport ATPase (probable substrate zinc/cadmium).
Nmlp_3316 protein networkhttps://string-db.org/network/268739.Nmlp_3316FMN-binding domain protein.
Nmlp_3317 protein networkhttps://string-db.org/network/268739.Nmlp_3317Probable secreted glycoprotein.
Nmlp_3318 protein networkhttps://string-db.org/network/268739.Nmlp_3318Probable secreted glycoprotein.
rnhB protein networkhttps://string-db.org/network/268739.Nmlp_3319Ribonuclease H, type 2; Endonuclease that specifically degrades the RNA of RNA-DNA hybrids; Belongs to the RNase HII family.
cofH protein networkhttps://string-db.org/network/268739.Nmlp_33207,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 2.
Nmlp_3321 protein networkhttps://string-db.org/network/268739.Nmlp_3321DUF790 family protein.
nthB protein networkhttps://string-db.org/network/268739.Nmlp_3322Endonuclease 3.
Nmlp_3323 protein networkhttps://string-db.org/network/268739.Nmlp_3323DUF371 family protein.
Nmlp_3324 protein networkhttps://string-db.org/network/268739.Nmlp_3324Uncharacterized protein.
Nmlp_3325 protein networkhttps://string-db.org/network/268739.Nmlp_3325AstE domain protein.
Nmlp_3326 protein networkhttps://string-db.org/network/268739.Nmlp_3326UPF0179 family protein; Belongs to the UPF0179 family.
acs2 protein networkhttps://string-db.org/network/268739.Nmlp_3327acyl-CoA synthetase.
Nmlp_3328 protein networkhttps://string-db.org/network/268739.Nmlp_3328Uncharacterized protein.
fadA4 protein networkhttps://string-db.org/network/268739.Nmlp_3330Enoyl-CoA hydratase; Gene has frameshifts and lacks a central region; locus_tag: Nmlp_3329; product: IS1341-type transposase NmIRS28 (nonfunctional); Belongs to the enoyl-CoA hydratase/isomerase [...]
Nmlp_3331 protein networkhttps://string-db.org/network/268739.Nmlp_3331LysE family transport protein.
Nmlp_3332 protein networkhttps://string-db.org/network/268739.Nmlp_3332HD family hydrolase.
Nmlp_3333 protein networkhttps://string-db.org/network/268739.Nmlp_3333DUF457 family protein.
Nmlp_3334 protein networkhttps://string-db.org/network/268739.Nmlp_3334GNAT family acetyltransferase.
Nmlp_3335 protein networkhttps://string-db.org/network/268739.Nmlp_3335Uncharacterized protein.
Nmlp_3336 protein networkhttps://string-db.org/network/268739.Nmlp_3336Dodecin.
Nmlp_3337 protein networkhttps://string-db.org/network/268739.Nmlp_3337AI-2E family transport protein.
Nmlp_3338 protein networkhttps://string-db.org/network/268739.Nmlp_3338Small CPxCG-related zinc finger protein.
Nmlp_3340 protein networkhttps://string-db.org/network/268739.Nmlp_3340Uncharacterized protein; Gene is interrupted (frameshift,in-frame stop) and is truncated at both termini; locus_tag: Nmlp_3339; product: IS1341-type transposase NmIRS27 (nonfunctional).
Nmlp_3341 protein networkhttps://string-db.org/network/268739.Nmlp_3341Uncharacterized protein.
Nmlp_3342 protein networkhttps://string-db.org/network/268739.Nmlp_3342Uncharacterized protein.
Nmlp_3343 protein networkhttps://string-db.org/network/268739.Nmlp_3343Uncharacterized protein.
Nmlp_3344 protein networkhttps://string-db.org/network/268739.Nmlp_3344Small CPxCG-related zinc finger protein.
Nmlp_3345 protein networkhttps://string-db.org/network/268739.Nmlp_3345Uncharacterized protein.
Nmlp_3346 protein networkhttps://string-db.org/network/268739.Nmlp_3346Uncharacterized protein.
Nmlp_3347 protein networkhttps://string-db.org/network/268739.Nmlp_3347Uncharacterized protein.
Nmlp_3349 protein networkhttps://string-db.org/network/268739.Nmlp_3349Uncharacterized protein.
Nmlp_3350 protein networkhttps://string-db.org/network/268739.Nmlp_3350Uncharacterized protein.
htr8a protein networkhttps://string-db.org/network/268739.Nmlp_3351Transducer protein Htr8.
Nmlp_3352 protein networkhttps://string-db.org/network/268739.Nmlp_3352Probable S-adenosylmethionine-dependent methyltransferase.
Nmlp_3353 protein networkhttps://string-db.org/network/268739.Nmlp_3353Flavin reductase domain protein.
Nmlp_3354 protein networkhttps://string-db.org/network/268739.Nmlp_3354Peptidase M20 family protein (homolog to carboxypeptidase).
Nmlp_3355 protein networkhttps://string-db.org/network/268739.Nmlp_3355Uncharacterized protein.
Nmlp_3356 protein networkhttps://string-db.org/network/268739.Nmlp_3356Homolog to cytochrome c-type biogenesis protein CcdA.
Nmlp_3357 protein networkhttps://string-db.org/network/268739.Nmlp_3357DUF2249 family protein.
Nmlp_3358 protein networkhttps://string-db.org/network/268739.Nmlp_3358Uncharacterized protein.
Nmlp_3359 protein networkhttps://string-db.org/network/268739.Nmlp_3359DUF2249 family protein.
Nmlp_3360 protein networkhttps://string-db.org/network/268739.Nmlp_3360Cupin 2 barrel domain protein.
Nmlp_3361 protein networkhttps://string-db.org/network/268739.Nmlp_3361DsrE domain protein.
Nmlp_3362 protein networkhttps://string-db.org/network/268739.Nmlp_3362Receiver/sensor box histidine kinase.
Nmlp_3365 protein networkhttps://string-db.org/network/268739.Nmlp_3365Glyoxalase domain protein.
sdhA2 protein networkhttps://string-db.org/network/268739.Nmlp_3366Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1.
dadA protein networkhttps://string-db.org/network/268739.Nmlp_3367Homolog to D-aspartate oxidase.
Nmlp_3368 protein networkhttps://string-db.org/network/268739.Nmlp_3368Uncharacterized protein.
cpx protein networkhttps://string-db.org/network/268739.Nmlp_3369CytC-type peroxidase.
Nmlp_3370 protein networkhttps://string-db.org/network/268739.Nmlp_3370Thioredoxin domain protein.
ccmF1 protein networkhttps://string-db.org/network/268739.Nmlp_3371Cytochrome c-type biogenesis protein CcmF.
ccmB protein networkhttps://string-db.org/network/268739.Nmlp_3372ABC-type transport system permease protein (probable substrate heme).
ccmA protein networkhttps://string-db.org/network/268739.Nmlp_3373ABC-type transport system ATP-binding protein (probable substrate heme).
ccmE protein networkhttps://string-db.org/network/268739.Nmlp_3374Cytochrome c-type biogenesis protein CcmE.
Nmlp_3375 protein networkhttps://string-db.org/network/268739.Nmlp_3375Molybdopterin-binding domain protein.
Nmlp_3376 protein networkhttps://string-db.org/network/268739.Nmlp_3376Uncharacterized protein.
ccmC protein networkhttps://string-db.org/network/268739.Nmlp_3377ABC-type transport system permease protein (probable substrate heme).
Nmlp_3378 protein networkhttps://string-db.org/network/268739.Nmlp_3378Uncharacterized protein.
Nmlp_3379 protein networkhttps://string-db.org/network/268739.Nmlp_3379Uncharacterized protein.
Nmlp_3380 protein networkhttps://string-db.org/network/268739.Nmlp_3380UspA domain protein.
Nmlp_3381 protein networkhttps://string-db.org/network/268739.Nmlp_3381Fumarylacetoacetase family protein.
Nmlp_3382 protein networkhttps://string-db.org/network/268739.Nmlp_3382MmgE/PrpD family protein.
Nmlp_3383 protein networkhttps://string-db.org/network/268739.Nmlp_3383UPF0361 family protein.
Nmlp_3384 protein networkhttps://string-db.org/network/268739.Nmlp_3384Uncharacterized protein.
Nmlp_3385 protein networkhttps://string-db.org/network/268739.Nmlp_3385Receiver/sensor box histidine kinase.
Nmlp_3387 protein networkhttps://string-db.org/network/268739.Nmlp_3387AstE domain protein.
htpX protein networkhttps://string-db.org/network/268739.Nmlp_3388HtpX-like protease; Belongs to the peptidase M48B family.
Nmlp_3389 protein networkhttps://string-db.org/network/268739.Nmlp_3389Uncharacterized protein.
cbf5 protein networkhttps://string-db.org/network/268739.Nmlp_3391tRNA-Pro; Could be responsible for synthesis of pseudouridine from uracil-55 in the psi GC loop of transfer RNAs; Belongs to the pseudouridine synthase TruB family. Type 2 subfamily.
cmk2 protein networkhttps://string-db.org/network/268739.Nmlp_3392Cytidylate kinase.
Nmlp_3393 protein networkhttps://string-db.org/network/268739.Nmlp_3393DUF106 family protein.
Nmlp_3394 protein networkhttps://string-db.org/network/268739.Nmlp_3394DUF3006 family protein.
Nmlp_3395 protein networkhttps://string-db.org/network/268739.Nmlp_3395Beta-lactamase domain protein.
Nmlp_3396 protein networkhttps://string-db.org/network/268739.Nmlp_3396Sensor box histidine kinase.
adk1 protein networkhttps://string-db.org/network/268739.Nmlp_3397Adenylate kinase; Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolis [...]
Nmlp_3398 protein networkhttps://string-db.org/network/268739.Nmlp_3398Uncharacterized protein.
Nmlp_3400 protein networkhttps://string-db.org/network/268739.Nmlp_3400DMT superfamily transport protein.
Nmlp_3401 protein networkhttps://string-db.org/network/268739.Nmlp_3401HTH domain protein.
Nmlp_3402 protein networkhttps://string-db.org/network/268739.Nmlp_3402Uncharacterized protein.
Nmlp_3403 protein networkhttps://string-db.org/network/268739.Nmlp_3403HTH domain protein.
Nmlp_3404 protein networkhttps://string-db.org/network/268739.Nmlp_3404Peptidase S26 domain protein.
Nmlp_3411 protein networkhttps://string-db.org/network/268739.Nmlp_3411Uncharacterized protein.
Nmlp_3412 protein networkhttps://string-db.org/network/268739.Nmlp_3412Uncharacterized protein.
Nmlp_3413 protein networkhttps://string-db.org/network/268739.Nmlp_3413Probable secreted glycoprotein.
Nmlp_3414 protein networkhttps://string-db.org/network/268739.Nmlp_3414Sensor box histidine kinase.
nuoA protein networkhttps://string-db.org/network/268739.Nmlp_3415NADH dehydrogenase-like complex subunit A.
nuoB protein networkhttps://string-db.org/network/268739.Nmlp_3416NADH dehydrogenase-like complex subunit B; Belongs to the complex I 20 kDa subunit family.
nuoCD protein networkhttps://string-db.org/network/268739.Nmlp_3417NADH dehydrogenase-like complex subunit CD.
nuoH protein networkhttps://string-db.org/network/268739.Nmlp_3418NADH dehydrogenase-like complex subunit H.
nuoI1 protein networkhttps://string-db.org/network/268739.Nmlp_3419NADH dehydrogenase-like complex subunit I.
nuoJ1 protein networkhttps://string-db.org/network/268739.Nmlp_3421Gene: nuoI2; product: NADH dehydrogenase-like complex subunit I (nonfunctional).
nuoJ2 protein networkhttps://string-db.org/network/268739.Nmlp_3422NADH dehydrogenase-like complex subunit J2.
nuoK protein networkhttps://string-db.org/network/268739.Nmlp_3423NADH dehydrogenase-like complex subunit K.
nuoL protein networkhttps://string-db.org/network/268739.Nmlp_3424NADH dehydrogenase-like complex subunit L.
nuoM protein networkhttps://string-db.org/network/268739.Nmlp_3425NADH dehydrogenase-like complex subunit M.
nuoN protein networkhttps://string-db.org/network/268739.Nmlp_3426NADH dehydrogenase-like complex subunit N.
Nmlp_3427 protein networkhttps://string-db.org/network/268739.Nmlp_3427DHH/RecJ family phosphoesterase.
cbs10 protein networkhttps://string-db.org/network/268739.Nmlp_3428CBS/parB domain protein.
Nmlp_3429 protein networkhttps://string-db.org/network/268739.Nmlp_3429Uncharacterized protein.
Nmlp_3430 protein networkhttps://string-db.org/network/268739.Nmlp_3430Uncharacterized protein.
Nmlp_3431 protein networkhttps://string-db.org/network/268739.Nmlp_3431Probable oxidoreductase (short-chain dehydrogenase family).
coxA protein networkhttps://string-db.org/network/268739.Nmlp_3433Cox-type terminal oxidase subunit I; Belongs to the heme-copper respiratory oxidase family.
Nmlp_3434 protein networkhttps://string-db.org/network/268739.Nmlp_3434Uncharacterized protein.
Nmlp_3435 protein networkhttps://string-db.org/network/268739.Nmlp_3435Uncharacterized protein.
coxC protein networkhttps://string-db.org/network/268739.Nmlp_3436Cox-type terminal oxidase subunit III.
coxB protein networkhttps://string-db.org/network/268739.Nmlp_3437Cox-type terminal oxidase subunit II.
ctaB protein networkhttps://string-db.org/network/268739.Nmlp_3438Protoheme IX geranylgeranyltransferase; Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Nmlp_3439 protein networkhttps://string-db.org/network/268739.Nmlp_3439GHMP family kinase (homolog to beta-ribofuranosylaminobenzene 5'-phosphate synthase); Catalyzes the condensation of 4-aminobenzoate (pABA) with 5- phospho-alpha-D-ribose 1-diphosphate (PRPP) to p [...]
Nmlp_3440 protein networkhttps://string-db.org/network/268739.Nmlp_3440Uncharacterized protein.
Nmlp_3441 protein networkhttps://string-db.org/network/268739.Nmlp_3441CopG domain protein.
Nmlp_3442 protein networkhttps://string-db.org/network/268739.Nmlp_3442Uncharacterized protein.
tfs2 protein networkhttps://string-db.org/network/268739.Nmlp_3443Transcription elongation factor TFS; Belongs to the archaeal rpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.
mntH protein networkhttps://string-db.org/network/268739.Nmlp_3444NRAMP family transport protein (probable substrate divalent metal cation).
Nmlp_3445 protein networkhttps://string-db.org/network/268739.Nmlp_3445phytanoyl-CoA dioxygenase domain protein.
apbC2 protein networkhttps://string-db.org/network/268739.Nmlp_3446Fe-S cluster carrier protein ApbC; Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP; Belongs to the Mrp/NBP35 ATP-binding proteins family.
Nmlp_3447 protein networkhttps://string-db.org/network/268739.Nmlp_3447Uncharacterized protein.
Nmlp_3448 protein networkhttps://string-db.org/network/268739.Nmlp_3448Probable anaerobic dehydrogenase membrane anchor subunit.
Nmlp_3449 protein networkhttps://string-db.org/network/268739.Nmlp_3449Probable anaerobic dehydrogenase iron-sulfur-binding subunit.
dhs protein networkhttps://string-db.org/network/268739.Nmlp_3450Deoxyhypusine synthase.
Nmlp_3453 protein networkhttps://string-db.org/network/268739.Nmlp_3453HD family hydrolase; Gene has an in-frame stop codon and is truncated at the C-terminus; product: uncharacterized protein (nonfunctional); locus_tag: Nmlp_3452A.
cofD protein networkhttps://string-db.org/network/268739.Nmlp_34542-phospho-L-lactate transferase; Catalyzes the transfer of the phosphoenolpyruvate moiety from enoylpyruvoyl-2-diphospho-5'-guanosine (EPPG) to 7,8-didemethyl-8- hydroxy-5-deazariboflavin (FO) wi [...]
dpd protein networkhttps://string-db.org/network/268739.Nmlp_3455Putative dihydropyrimidine dehydrogenase.
citG protein networkhttps://string-db.org/network/268739.Nmlp_3456triphosphoribosyl-dephospho-CoA synthase.
Nmlp_3457 protein networkhttps://string-db.org/network/268739.Nmlp_3457DUF447 family protein.
znuA1 protein networkhttps://string-db.org/network/268739.Nmlp_3458ABC-type transport system periplasmic substrate-binding protein (probable substrate zinc).
znuC1 protein networkhttps://string-db.org/network/268739.Nmlp_3459ABC-type transport system ATP-binding protein (probable substrate zinc).
znuB1 protein networkhttps://string-db.org/network/268739.Nmlp_3460ABC-type transport system permease protein (probable substrate zinc).
ureF protein networkhttps://string-db.org/network/268739.Nmlp_3461Urease accessory protein UreF.
ureE protein networkhttps://string-db.org/network/268739.Nmlp_3462Urease accessory protein UreE; Involved in urease metallocenter assembly. Binds nickel. Probably functions as a nickel donor during metallocenter assembly. Belongs to the UreE family.
ureD protein networkhttps://string-db.org/network/268739.Nmlp_3463Urease accessory protein UreD; Required for maturation of urease via the functional incorporation of the urease nickel metallocenter.
ureG protein networkhttps://string-db.org/network/268739.Nmlp_3464Urease accessory protein UreG; Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.
ureA protein networkhttps://string-db.org/network/268739.Nmlp_3465Urease gamma subunit; Belongs to the urease gamma subunit family.
ureC protein networkhttps://string-db.org/network/268739.Nmlp_3466Urease alpha subunit.
ureB protein networkhttps://string-db.org/network/268739.Nmlp_3467Urease beta subunit; Belongs to the urease beta subunit family.
Nmlp_3468 protein networkhttps://string-db.org/network/268739.Nmlp_3468Uncharacterized protein.
urtA protein networkhttps://string-db.org/network/268739.Nmlp_3469ABC-type transport system periplasmic substrate-binding protein (probable substrate urea/short-chain amides).
urtB protein networkhttps://string-db.org/network/268739.Nmlp_3470ABC-type transport system permease protein (probable substrate urea/short-chain amides).
urtC protein networkhttps://string-db.org/network/268739.Nmlp_3471ABC-type transport system permease protein (probable substrate urea/short-chain amides).
urtD protein networkhttps://string-db.org/network/268739.Nmlp_3472ABC-type transport system ATP-binding protein (probable substrate urea/short-chain amides).
urtE protein networkhttps://string-db.org/network/268739.Nmlp_3473ABC-type transport system ATP-binding protein (probable substrate urea/short-chain amides).
rps17e protein networkhttps://string-db.org/network/268739.Nmlp_347430S ribosomal protein S17e; Belongs to the eukaryotic ribosomal protein eS17 family.
asd protein networkhttps://string-db.org/network/268739.Nmlp_3475Aspartate-semialdehyde dehydrogenase.
Nmlp_3476 protein networkhttps://string-db.org/network/268739.Nmlp_3476Uncharacterized protein.
Nmlp_3477 protein networkhttps://string-db.org/network/268739.Nmlp_3477Cyclase family protein.
phoU2 protein networkhttps://string-db.org/network/268739.Nmlp_3478PhoU domain protein; Plays a role in the regulation of phosphate uptake.
pstB1 protein networkhttps://string-db.org/network/268739.Nmlp_3479ABC-type transport system ATP-binding protein (probable substrate phosphate); Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the tran [...]
phoU1 protein networkhttps://string-db.org/network/268739.Nmlp_3480PhoU domain protein.
Nmlp_3481 protein networkhttps://string-db.org/network/268739.Nmlp_3481Uncharacterized protein.
guaAb protein networkhttps://string-db.org/network/268739.Nmlp_3482GMP synthase (glutamine-hydrolyzing) subunit B; Catalyzes the synthesis of GMP from XMP.
pyrG protein networkhttps://string-db.org/network/268739.Nmlp_3483CTP synthase; Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Regulates intracellular CTP levels through interactions with the fo [...]
trkA1 protein networkhttps://string-db.org/network/268739.Nmlp_3484TrkA domain protein.
Nmlp_3486 protein networkhttps://string-db.org/network/268739.Nmlp_3486FNT family transport protein; Gene is interrupted (frameshift,in-frame stop) and lacks a large central region; locus_tag: Nmlp_3485; product: Trk-type transport system (probable substrate potassi [...]
tfbA7 protein networkhttps://string-db.org/network/268739.Nmlp_3487Transcription initiation factor TFB.
Nmlp_3488 protein networkhttps://string-db.org/network/268739.Nmlp_3488FAD-dependent oxidoreductase.
korA protein networkhttps://string-db.org/network/268739.Nmlp_3489Oxoglutarate--ferredoxin oxidoreductase alpha subunit.
korB1 protein networkhttps://string-db.org/network/268739.Nmlp_3490Oxoglutarate--ferredoxin oxidoreductase beta subunit.
entB2 protein networkhttps://string-db.org/network/268739.Nmlp_3491Isochorismatase family protein.
aspS protein networkhttps://string-db.org/network/268739.Nmlp_3492aspartate--tRNA(Asp/Asn) ligase; Aspartyl-tRNA synthetase with relaxed tRNA specificity since it is able to aspartylate not only its cognate tRNA(Asp) but also tRNA(Asn). Reaction proceeds in two [...]
Nmlp_3493 protein networkhttps://string-db.org/network/268739.Nmlp_3493Uncharacterized protein.
hemC protein networkhttps://string-db.org/network/268739.Nmlp_3494Hydroxymethylbilane synthase (porphobilinogen deaminase).
sirA protein networkhttps://string-db.org/network/268739.Nmlp_3495uroporphyrin-III C-methyltransferase; Belongs to the precorrin methyltransferase family.
hemD protein networkhttps://string-db.org/network/268739.Nmlp_3496uroporphyrinogen-III synthase.
rfcC protein networkhttps://string-db.org/network/268739.Nmlp_3497Replication factor C small subunit.
trmG10 protein networkhttps://string-db.org/network/268739.Nmlp_3498tRNA (guanine(10),N(2))-dimethyltransferase.
CDN30066.1 protein networkhttps://string-db.org/network/268739.Nmlp_3501AUncharacterized protein.
Nmlp_3502 protein networkhttps://string-db.org/network/268739.Nmlp_3502DUF2237 family protein.
Nmlp_3503 protein networkhttps://string-db.org/network/268739.Nmlp_3503UPF0033 family protein.
Nmlp_3504 protein networkhttps://string-db.org/network/268739.Nmlp_3504FAD-dependent oxidoreductase.
Nmlp_3505 protein networkhttps://string-db.org/network/268739.Nmlp_3505DUF1641 domain protein.
Nmlp_3506 protein networkhttps://string-db.org/network/268739.Nmlp_3506Receiver/sensor box histidine kinase.
Nmlp_3507 protein networkhttps://string-db.org/network/268739.Nmlp_3507GNAT family acetyltransferase.
phr1 protein networkhttps://string-db.org/network/268739.Nmlp_3508Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family.
Nmlp_3509 protein networkhttps://string-db.org/network/268739.Nmlp_3509Uncharacterized protein.
dim2 protein networkhttps://string-db.org/network/268739.Nmlp_3510Probable ribosome biogenesis protein Dim2.
ths1 protein networkhttps://string-db.org/network/268739.Nmlp_3511Thermosome subunit 1; Belongs to the TCP-1 chaperonin family.
aspC2 protein networkhttps://string-db.org/network/268739.Nmlp_3512Pyridoxal phosphate-dependent aminotransferase.
ssuA protein networkhttps://string-db.org/network/268739.Nmlp_3513ABC-type transport system periplasmic substrate-binding protein (probable substrate nitrate/sulfonate/bicarbonate).
ssuC protein networkhttps://string-db.org/network/268739.Nmlp_3514ABC-type transport system permease protein (probable substrate nitrate/sulfonate/bicarbonate).
ssuB protein networkhttps://string-db.org/network/268739.Nmlp_3515ABC-type transport system ATP-binding protein (probable substrate nitrate/sulfonate/bicarbonate).
Nmlp_3516 protein networkhttps://string-db.org/network/268739.Nmlp_3516Uncharacterized protein.
Nmlp_3517 protein networkhttps://string-db.org/network/268739.Nmlp_3517Probable secreted glycoprotein.
Nmlp_3518 protein networkhttps://string-db.org/network/268739.Nmlp_3518Probable secreted glycoprotein.
Nmlp_3519 protein networkhttps://string-db.org/network/268739.Nmlp_3519HTH domain protein.
Nmlp_3520 protein networkhttps://string-db.org/network/268739.Nmlp_3520Uncharacterized protein.
Nmlp_3521 protein networkhttps://string-db.org/network/268739.Nmlp_3521DUF192 family protein.
Nmlp_3522 protein networkhttps://string-db.org/network/268739.Nmlp_3522Sensor box histidine kinase.
Nmlp_3523 protein networkhttps://string-db.org/network/268739.Nmlp_3523S8 family serine protease.
Nmlp_3524 protein networkhttps://string-db.org/network/268739.Nmlp_3524Uncharacterized protein.
Nmlp_3525 protein networkhttps://string-db.org/network/268739.Nmlp_3525HTH domain protein.
aglI protein networkhttps://string-db.org/network/268739.Nmlp_3526Glycosyltransferase AglI; Product: IS1341-type transposase NmIRS70 (nonfunctional).
Nmlp_3527 protein networkhttps://string-db.org/network/268739.Nmlp_3527Uncharacterized protein.
Nmlp_3528 protein networkhttps://string-db.org/network/268739.Nmlp_3528UPF0175 family protein.
Nmlp_3529 protein networkhttps://string-db.org/network/268739.Nmlp_3529AlkP-core domain protein.
Nmlp_3530 protein networkhttps://string-db.org/network/268739.Nmlp_3530Uncharacterized protein.
Nmlp_3531 protein networkhttps://string-db.org/network/268739.Nmlp_3531AlkP-core domain protein.
Nmlp_3532 protein networkhttps://string-db.org/network/268739.Nmlp_3532AlkP-core domain protein.
aglR protein networkhttps://string-db.org/network/268739.Nmlp_3533Probable flippase AglR.
Nmlp_3534 protein networkhttps://string-db.org/network/268739.Nmlp_3534Uncharacterized protein.
aglG protein networkhttps://string-db.org/network/268739.Nmlp_3535Glycosyltransferase AglG.
vapB2 protein networkhttps://string-db.org/network/268739.Nmlp_3536Probable VapB/AbrB family antitoxin.
vapC2 protein networkhttps://string-db.org/network/268739.Nmlp_3537Probable ribonuclease VapC.
Nmlp_3539 protein networkhttps://string-db.org/network/268739.Nmlp_3539Product: probable secreted glycoprotein (nonfunctional).
Nmlp_3540 protein networkhttps://string-db.org/network/268739.Nmlp_3540Uncharacterized protein.
Nmlp_3541 protein networkhttps://string-db.org/network/268739.Nmlp_3541Uncharacterized protein.
Nmlp_3542 protein networkhttps://string-db.org/network/268739.Nmlp_3542Probable secreted glycoprotein.
Nmlp_3543 protein networkhttps://string-db.org/network/268739.Nmlp_3543Homolog to arabinopyranose mutase.
SfuA protein networkhttps://string-db.org/network/268739.Nmlp_3544ABC-type transport system periplasmic substrate-binding protein.
Nmlp_3545 protein networkhttps://string-db.org/network/268739.Nmlp_3545Uncharacterized protein.
Nmlp_3546 protein networkhttps://string-db.org/network/268739.Nmlp_3546Uncharacterized protein.
gtl8 protein networkhttps://string-db.org/network/268739.Nmlp_3547Dolichyl-phosphate hexosyltransferase.
Nmlp_3548 protein networkhttps://string-db.org/network/268739.Nmlp_3548GMC family oxidoreductase.
Nmlp_3549 protein networkhttps://string-db.org/network/268739.Nmlp_3549LacC domain protein.
SfuB protein networkhttps://string-db.org/network/268739.Nmlp_3550ABC-type transport system permease protein.
aglF protein networkhttps://string-db.org/network/268739.Nmlp_3551UTP--glucose-1-phosphate uridylyltransferase AglF.
Nmlp_3552 protein networkhttps://string-db.org/network/268739.Nmlp_3552Uncharacterized protein.
alaS protein networkhttps://string-db.org/network/268739.Nmlp_3553alanine--tRNA ligase; Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA( [...]
Nmlp_3554 protein networkhttps://string-db.org/network/268739.Nmlp_3554Small CPxCG-related zinc finger protein.
Nmlp_3555 protein networkhttps://string-db.org/network/268739.Nmlp_3555Uncharacterized protein.
Nmlp_3556 protein networkhttps://string-db.org/network/268739.Nmlp_3556Uncharacterized protein.
ala protein networkhttps://string-db.org/network/268739.Nmlp_3557Alanine dehydrogenase; Catalyzes the NAD(+)-dependent oxidative deamination of L- alanine to pyruvate, and the reverse reaction, the reductive amination of pyruvate; Belongs to the ornithine cycl [...]
htr41 protein networkhttps://string-db.org/network/268739.Nmlp_3558Transducer protein Htr41.
Nmlp_3559 protein networkhttps://string-db.org/network/268739.Nmlp_3559Uncharacterized protein.
Nmlp_3561 protein networkhttps://string-db.org/network/268739.Nmlp_3561Homolog to DNA topoisomerase 1.
endA protein networkhttps://string-db.org/network/268739.Nmlp_3562tRNA-splicing endonuclease; Endonuclease that removes tRNA introns. Cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules be [...]
trpS protein networkhttps://string-db.org/network/268739.Nmlp_3563tryptophan--tRNA ligase; Catalyzes the attachment of tryptophan to tRNA(Trp).
gcvT protein networkhttps://string-db.org/network/268739.Nmlp_3564Homolog to glycine cleavage system protein T.
Nmlp_3565 protein networkhttps://string-db.org/network/268739.Nmlp_3565Uncharacterized protein.
Nmlp_3566 protein networkhttps://string-db.org/network/268739.Nmlp_3566Uncharacterized protein.
Nmlp_3567 protein networkhttps://string-db.org/network/268739.Nmlp_3567Uncharacterized protein.
Nmlp_3568 protein networkhttps://string-db.org/network/268739.Nmlp_3568DUF2157 domain protein.
Nmlp_3569 protein networkhttps://string-db.org/network/268739.Nmlp_3569Uncharacterized protein.
idsA2 protein networkhttps://string-db.org/network/268739.Nmlp_3570Bifunctional short chain isoprenyl diphosphate synthase; Belongs to the FPP/GGPP synthase family.
prsA protein networkhttps://string-db.org/network/268739.Nmlp_3571Ribose-phosphate pyrophosphokinase; Involved in the biosynthesis of the central metabolite phospho-alpha-D-ribosyl-1-pyrophosphate (PRPP) via the transfer of pyrophosphoryl group from ATP to 1-hy [...]
Nmlp_3572 protein networkhttps://string-db.org/network/268739.Nmlp_3572Probable secreted glycoprotein.
ileS protein networkhttps://string-db.org/network/268739.Nmlp_3573isoleucine--tRNA ligase; Catalyzes the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such err [...]
pmm2 protein networkhttps://string-db.org/network/268739.Nmlp_3574Phosphohexomutase (phosphoglucomutase / phosphomannomutase); Belongs to the phosphohexose mutase family.
recJ1 protein networkhttps://string-db.org/network/268739.Nmlp_3575single-stranded-DNA-specific exonuclease RecJ1.
crtI2 protein networkhttps://string-db.org/network/268739.Nmlp_3576Phytoene dehydrogenase (phytoene desaturase).
brp protein networkhttps://string-db.org/network/268739.Nmlp_3577Beta-carotene 15,15'-dioxygenase Brp; Catalyzes the cleavage of beta-carotene at its central double bond (15,15') to yield two molecules of all-trans-retinal. Belongs to the Brp/Blh beta-carotene [...]
Nmlp_3578 protein networkhttps://string-db.org/network/268739.Nmlp_3578PgpA domain protein.
ncsA protein networkhttps://string-db.org/network/268739.Nmlp_3579Zinc-dependent nuclease.
Nmlp_3580 protein networkhttps://string-db.org/network/268739.Nmlp_3580TrmB family transcription regulator.
amtB2 protein networkhttps://string-db.org/network/268739.Nmlp_3581Transport protein (probable substrate ammonium).
Nmlp_3582 protein networkhttps://string-db.org/network/268739.Nmlp_3582GlnK-type ammonia transport regulator; Belongs to the P(II) protein family.
Nmlp_3583 protein networkhttps://string-db.org/network/268739.Nmlp_3583Amine oxidase (copper-containing); Belongs to the copper/topaquinone oxidase family.
Nmlp_3584 protein networkhttps://string-db.org/network/268739.Nmlp_3584Uncharacterized protein.
rad25a protein networkhttps://string-db.org/network/268739.Nmlp_3585DNA repair helicase Rad25.
grpE protein networkhttps://string-db.org/network/268739.Nmlp_3586DnaJ/DnaK ATPase stimulator GrpE; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and Grp [...]
dnaK protein networkhttps://string-db.org/network/268739.Nmlp_3588Hsp70-type molecular chaperone DnaK; Acts as a chaperone.
CCQ37711.1 protein networkhttps://string-db.org/network/268739.Nmlp_3589AUncharacterized protein.
dnaJ protein networkhttps://string-db.org/network/268739.Nmlp_3591Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in a [...]
Nmlp_3592 protein networkhttps://string-db.org/network/268739.Nmlp_3592Uncharacterized protein.
Nmlp_3593 protein networkhttps://string-db.org/network/268739.Nmlp_3593Uncharacterized protein.
sppA1 protein networkhttps://string-db.org/network/268739.Nmlp_3594Signal peptide peptidase SppA.
Nmlp_3595 protein networkhttps://string-db.org/network/268739.Nmlp_3595UPF0753 family protein; Belongs to the UPF0753 family.
mrpD4 protein networkhttps://string-db.org/network/268739.Nmlp_3596Mrp-type sodium/proton antiporter system subunit D4.
Nmlp_3598 protein networkhttps://string-db.org/network/268739.Nmlp_3598VanZ family protein; Product: uncharacterized protein (nonfunctional).
Nmlp_3599 protein networkhttps://string-db.org/network/268739.Nmlp_3599TIGR01210 family protein.
Nmlp_3601 protein networkhttps://string-db.org/network/268739.Nmlp_3601MATE efflux family protein.
Nmlp_3602 protein networkhttps://string-db.org/network/268739.Nmlp_3602Uncharacterized protein.
Nmlp_3603 protein networkhttps://string-db.org/network/268739.Nmlp_3603Small CPxCG-related zinc finger protein.
purQ protein networkhttps://string-db.org/network/268739.Nmlp_3604Phosphoribosylformylglycinamidine synthase subunit PurQ; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent c [...]
purS protein networkhttps://string-db.org/network/268739.Nmlp_3605Phosphoribosylformylglycinamidine synthase subunit PurS; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent c [...]
Nmlp_3606 protein networkhttps://string-db.org/network/268739.Nmlp_3606Uncharacterized protein.
Nmlp_3607 protein networkhttps://string-db.org/network/268739.Nmlp_3607Uncharacterized protein.
Nmlp_3608 protein networkhttps://string-db.org/network/268739.Nmlp_3608Probable FAD-dependent oxidoreductase.
Nmlp_3610 protein networkhttps://string-db.org/network/268739.Nmlp_3610IS200-type transposase ISNamo19; Gene is interrupted (frameshift,in-frame stop) and is truncated at the N-terminus; locus_tag: Nmlp_3609; product: ISH14-type transposase NmIRS15 (nonfunctional).
Nmlp_3611 protein networkhttps://string-db.org/network/268739.Nmlp_3611IS1341-type transposase ISNamo19.
Nmlp_3612 protein networkhttps://string-db.org/network/268739.Nmlp_3612Homolog to S-adenosylmethionine-dependent methyltransferase.
htr8b protein networkhttps://string-db.org/network/268739.Nmlp_3615Transducer protein Htr8; Product: major facilitator superfamily transporter (probable substrate nitrate/nitrite) (nonfunctional).
Nmlp_3616 protein networkhttps://string-db.org/network/268739.Nmlp_3616Receiver/sensor box protein.
Nmlp_3619 protein networkhttps://string-db.org/network/268739.Nmlp_3619ABC-type transport system permease protein (Probable substrate glucose); Product: uncharacterized protein (nonfunctional).
Nmlp_3620 protein networkhttps://string-db.org/network/268739.Nmlp_3620ABC-type transport system permease protein (probable substrate glucose).
Nmlp_3621 protein networkhttps://string-db.org/network/268739.Nmlp_3621ABC-type transport system ATP-binding protein (probable substrate glucose).
Nmlp_3622 protein networkhttps://string-db.org/network/268739.Nmlp_3622ABC-type transport system periplasmic substrate-binding protein (probable substrate glucose).
pucM protein networkhttps://string-db.org/network/268739.Nmlp_36235-hydroxyisourate hydrolase.
pucL1 protein networkhttps://string-db.org/network/268739.Nmlp_3624Uricase; Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin.
pucL2 protein networkhttps://string-db.org/network/268739.Nmlp_36252-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase.
pucH protein networkhttps://string-db.org/network/268739.Nmlp_3626Probable allantoinase.
mobA2 protein networkhttps://string-db.org/network/268739.Nmlp_3627Molybdenum cofactor nucleotidyltransferase domain protein.
Nmlp_3628 protein networkhttps://string-db.org/network/268739.Nmlp_3628Metal dependent hydrolase family protein.
coxM protein networkhttps://string-db.org/network/268739.Nmlp_3629Molybdopterin-containing oxidoreductase medium subunit.
coxL protein networkhttps://string-db.org/network/268739.Nmlp_3630Molybdopterin-containing oxidoreductase large subunit.
coxS protein networkhttps://string-db.org/network/268739.Nmlp_3631Molybdopterin-containing oxidoreductase small subunit.
xdhC protein networkhttps://string-db.org/network/268739.Nmlp_3632XdhC family protein.
uraA2 protein networkhttps://string-db.org/network/268739.Nmlp_3633Xanthine/uracil permease family transport protein.
Nmlp_3634 protein networkhttps://string-db.org/network/268739.Nmlp_3634Uncharacterized protein.
Nmlp_3636 protein networkhttps://string-db.org/network/268739.Nmlp_3636Amidase (hydantoinase/carbamoylase family).
Nmlp_3637 protein networkhttps://string-db.org/network/268739.Nmlp_3637IclR family transcription regulator.
Nmlp_3639 protein networkhttps://string-db.org/network/268739.Nmlp_3639ISH14-type transposase ISNamo7.
Nmlp_3640 protein networkhttps://string-db.org/network/268739.Nmlp_3640Uncharacterized protein.
Nmlp_3641 protein networkhttps://string-db.org/network/268739.Nmlp_3641GalE family epimerase/dehydratase.
pyrE2 protein networkhttps://string-db.org/network/268739.Nmlp_3642Homolog to orotate phosphoribosyltransferase; Belongs to the purine/pyrimidine phosphoribosyltransferase family.
glpC protein networkhttps://string-db.org/network/268739.Nmlp_3643Glycerol-3-phosphate dehydrogenase subunit C.
glpB protein networkhttps://string-db.org/network/268739.Nmlp_3644Glycerol-3-phosphate dehydrogenase subunit B.
glpA1 protein networkhttps://string-db.org/network/268739.Nmlp_3645Glycerol-3-phosphate dehydrogenase subunit A; Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family.
glpK1 protein networkhttps://string-db.org/network/268739.Nmlp_3646Glycerol kinase; Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn- glycerol 3-phosphate.
Nmlp_3647 protein networkhttps://string-db.org/network/268739.Nmlp_3647Uncharacterized protein.
orc6 protein networkhttps://string-db.org/network/268739.Nmlp_3648Orc1-type DNA replication protein.
mtfK3 protein networkhttps://string-db.org/network/268739.Nmlp_3650FKBP-type peptidylprolyl isomerase.
Nmlp_3651 protein networkhttps://string-db.org/network/268739.Nmlp_3651Lrp/AsnC family transcription regulator.
GuaD3 protein networkhttps://string-db.org/network/268739.Nmlp_3652Amidohydrolase domain protein.
Nmlp_3653 protein networkhttps://string-db.org/network/268739.Nmlp_3653ISH14-type transposase ISNamo9.
Nmlp_3655 protein networkhttps://string-db.org/network/268739.Nmlp_3655Uncharacterized protein; Gene has a frameshift; locus_tag: Nmlp_3654; product: probable S-adenosylmethionine-dependent methyltransferase (nonfunctional); conceptual translation after in silico re [...]
Nmlp_3656 protein networkhttps://string-db.org/network/268739.Nmlp_3656NMT1/THI5 domain protein.
Nmlp_3657 protein networkhttps://string-db.org/network/268739.Nmlp_3657ABC-type transport system periplasmic substrate-binding protein.
Nmlp_3658 protein networkhttps://string-db.org/network/268739.Nmlp_3658ABC-type transport system periplasmic substrate-binding protein.
Nmlp_3659 protein networkhttps://string-db.org/network/268739.Nmlp_3659Cupin 2 barrel domain protein.
aor2 protein networkhttps://string-db.org/network/268739.Nmlp_3660Aldehyde ferredoxin oxidoreductase.
Nmlp_3661 protein networkhttps://string-db.org/network/268739.Nmlp_3661Glyoxalase domain protein.
aor1 protein networkhttps://string-db.org/network/268739.Nmlp_3663Aldehyde ferredoxin oxidoreductase; Product: probable DNA-binding protein (nonfunctional).
Nmlp_3664 protein networkhttps://string-db.org/network/268739.Nmlp_3664Uncharacterized protein.
Nmlp_3665 protein networkhttps://string-db.org/network/268739.Nmlp_3665ThiJ/PfpI domain protein.
Nmlp_3666 protein networkhttps://string-db.org/network/268739.Nmlp_3666Uncharacterized protein.
fadA3 protein networkhttps://string-db.org/network/268739.Nmlp_3667enoyl-CoA hydratase.
samp1 protein networkhttps://string-db.org/network/268739.Nmlp_3668Ubiquitin-like modifier protein SAMP1.
tgtA protein networkhttps://string-db.org/network/268739.Nmlp_3669tRNA-guanine(15) transglycosylase; Exchanges the guanine residue with 7-cyano-7-deazaguanine (preQ0) at position 15 in the dihydrouridine loop (D-loop) of archaeal tRNAs; Belongs to the archaeosi [...]
Nmlp_3670 protein networkhttps://string-db.org/network/268739.Nmlp_3670NikR family transcription regulator; Transcriptional regulator; Belongs to the transcriptional regulatory CopG/NikR family.
cobA protein networkhttps://string-db.org/network/268739.Nmlp_3671cob(I)alamin adenosyltransferase.
Nmlp_3672 protein networkhttps://string-db.org/network/268739.Nmlp_3672Uncharacterized protein.
Nmlp_3673 protein networkhttps://string-db.org/network/268739.Nmlp_3673UspA domain protein.
Nmlp_3674 protein networkhttps://string-db.org/network/268739.Nmlp_3674SSSF family transport protein; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
Nmlp_3675 protein networkhttps://string-db.org/network/268739.Nmlp_3675DUF4212 family protein.
Nmlp_3676 protein networkhttps://string-db.org/network/268739.Nmlp_3676ISH9-type transposase ISNamo1.
acs5 protein networkhttps://string-db.org/network/268739.Nmlp_3677acyl-CoA synthetase.
fadA1 protein networkhttps://string-db.org/network/268739.Nmlp_3678enoyl-CoA hydratase.
trxA7 protein networkhttps://string-db.org/network/268739.Nmlp_3679Thioredoxin.
livF2 protein networkhttps://string-db.org/network/268739.Nmlp_3680ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acids).
livG2 protein networkhttps://string-db.org/network/268739.Nmlp_3681ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acids).
livM2 protein networkhttps://string-db.org/network/268739.Nmlp_3682ABC-type transport system permease protein (probable substrate branched-chain amino acids).
livH2 protein networkhttps://string-db.org/network/268739.Nmlp_3683ABC-type transport system permease protein (probable substrate branched-chain amino acids).
livJ2 protein networkhttps://string-db.org/network/268739.Nmlp_3684ABC-type transport system periplasmic substrate-binding protein (probable substrate branched-chain amino acids).
acs4 protein networkhttps://string-db.org/network/268739.Nmlp_3685acyl-CoA synthetase.
Nmlp_3686 protein networkhttps://string-db.org/network/268739.Nmlp_3686Integrase family protein / sensor/bat box HTH-10 family transcription regulator.
acs3 protein networkhttps://string-db.org/network/268739.Nmlp_3687acyl-CoA synthetase.
cbiP protein networkhttps://string-db.org/network/268739.Nmlp_3688Adenosylcobyrate synthase; Catalyzes amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide. NH(2) groups are provided by glutamine, and one molecule of ATP is hydrogenolyzed for [...]
Nmlp_3689 protein networkhttps://string-db.org/network/268739.Nmlp_3689Probable S-adenosylmethionine-dependent methyltransferase.
Nmlp_3690 protein networkhttps://string-db.org/network/268739.Nmlp_3690Small CPxCG-related zinc finger protein.
apn1 protein networkhttps://string-db.org/network/268739.Nmlp_3691Endonuclease 4; Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-ph [...]
lpl1 protein networkhttps://string-db.org/network/268739.Nmlp_3692Lipoate-protein ligase domain protein.
trkH1 protein networkhttps://string-db.org/network/268739.Nmlp_3693Trk-type transport system (probable substrate potassium).
Nmlp_3694 protein networkhttps://string-db.org/network/268739.Nmlp_3694Ribonuclease H domain protein.
Nmlp_3695 protein networkhttps://string-db.org/network/268739.Nmlp_3695PfpI family protease.
Nmlp_3697 protein networkhttps://string-db.org/network/268739.Nmlp_3697Small CPxCG-related zinc finger protein.
korB3 protein networkhttps://string-db.org/network/268739.Nmlp_3698Oxoglutarate--ferredoxin oxidoreductase beta subunit.
Nmlp_3699 protein networkhttps://string-db.org/network/268739.Nmlp_3699Uncharacterized protein.
ferB2 protein networkhttps://string-db.org/network/268739.Nmlp_3700Ferredoxin (3Fe-4S)(4Fe-4S), zinc-containing; Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.
sufB4 protein networkhttps://string-db.org/network/268739.Nmlp_3701SufB domain protein.
tfbA8 protein networkhttps://string-db.org/network/268739.Nmlp_3702Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).
Nmlp_3703 protein networkhttps://string-db.org/network/268739.Nmlp_3703Small CPxCG-related zinc finger protein.
cbs11 protein networkhttps://string-db.org/network/268739.Nmlp_3704DUF21/CBS domain protein.
Nmlp_3707 protein networkhttps://string-db.org/network/268739.Nmlp_3707Sensor/bat box HTH-10 family transcription regulator.
Nmlp_3709 protein networkhttps://string-db.org/network/268739.Nmlp_3709Probable secreted glycoprotein.
Nmlp_3711 protein networkhttps://string-db.org/network/268739.Nmlp_3711Uncharacterized protein; Gene has a frameshift and lacks a large central region; locus_tag: Nmlp_3710; product: ISH7-type transposase NmIRS24 (nonfunctional).
Nmlp_3712 protein networkhttps://string-db.org/network/268739.Nmlp_3712MiaB-like tRNA modifying enzyme.
nac protein networkhttps://string-db.org/network/268739.Nmlp_3714Nascent polypeptide-associated complex protein; Contacts the emerging nascent chain on the ribosome. Belongs to the NAC-alpha family.
trmI protein networkhttps://string-db.org/network/268739.Nmlp_3715tRNA (adenine-N(1))-methyltransferase TrmI.
Nmlp_3716 protein networkhttps://string-db.org/network/268739.Nmlp_3716Uncharacterized protein.
Nmlp_3717 protein networkhttps://string-db.org/network/268739.Nmlp_3717DUF3179 family protein.
tfs1 protein networkhttps://string-db.org/network/268739.Nmlp_3718Transcription elongation factor TFS; Belongs to the archaeal rpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.
bac protein networkhttps://string-db.org/network/268739.Nmlp_3719Bacterioopsin-associated chaperone.
bap protein networkhttps://string-db.org/network/268739.Nmlp_3720Bacterioopsin-associated protein.
bop protein networkhttps://string-db.org/network/268739.Nmlp_3721Bacteriorhodopsin.
Nmlp_3723 protein networkhttps://string-db.org/network/268739.Nmlp_3723Transport protein (probable substrate arsenite).
Nmlp_3724 protein networkhttps://string-db.org/network/268739.Nmlp_3724DUF393 family protein.
engB protein networkhttps://string-db.org/network/268739.Nmlp_3725Probable GTP-binding protein EngB; Necessary for normal cell division and for the maintenance of normal septation.
Nmlp_3726 protein networkhttps://string-db.org/network/268739.Nmlp_3726DUF389 family protein.
Nmlp_3727 protein networkhttps://string-db.org/network/268739.Nmlp_3727SIMPL domain protein.
maoC4 protein networkhttps://string-db.org/network/268739.Nmlp_3728MaoC domain protein.
Nmlp_3729 protein networkhttps://string-db.org/network/268739.Nmlp_3729Probable GTP-binding protein.
hjc protein networkhttps://string-db.org/network/268739.Nmlp_3730Holliday junction resolvase Hjc; A structure-specific endonuclease that resolves Holliday junction (HJ) intermediates during genetic recombination. Cleaves 4-way DNA junctions introducing paired [...]
Nmlp_3731 protein networkhttps://string-db.org/network/268739.Nmlp_3731Deaminase domain protein.
Nmlp_3732 protein networkhttps://string-db.org/network/268739.Nmlp_3732ABCE1 family ribosome recycling factor.
Nmlp_3733 protein networkhttps://string-db.org/network/268739.Nmlp_3733Uncharacterized protein.
Nmlp_3734 protein networkhttps://string-db.org/network/268739.Nmlp_3734NP_1176A family transcription regulator.
pstS2 protein networkhttps://string-db.org/network/268739.Nmlp_3735ABC-type transport system periplasmic substrate-binding protein (probable substrate phosphate).
pstC1 protein networkhttps://string-db.org/network/268739.Nmlp_3736ABC-type transport system permease protein (probable substrate phosphate); Part of the binding-protein-dependent transport system for phosphate; probably responsible for the translocation of the [...]
pstA3 protein networkhttps://string-db.org/network/268739.Nmlp_3737ABC-type transport system permease protein (probable substrate phosphate).
pstB3 protein networkhttps://string-db.org/network/268739.Nmlp_3738ABC-type transport system ATP-binding protein (probable substrate phosphate); Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the tran [...]
Nmlp_3739 protein networkhttps://string-db.org/network/268739.Nmlp_3739Uncharacterized protein.
tupA protein networkhttps://string-db.org/network/268739.Nmlp_3740ABC-type transport system periplasmic substrate-binding protein (probable substrate tungstate).
tupB protein networkhttps://string-db.org/network/268739.Nmlp_3741ABC-type transport system permease protein (probable substrate tungstate).
tupC protein networkhttps://string-db.org/network/268739.Nmlp_3742ABC-type transport system ATP-binding protein (probable substrate tungstate).
Nmlp_3743 protein networkhttps://string-db.org/network/268739.Nmlp_3743ModE family transcription regulator.
Nmlp_3744 protein networkhttps://string-db.org/network/268739.Nmlp_3744Sensor box histidine kinase.
ppk protein networkhttps://string-db.org/network/268739.Nmlp_3745Polyphosphate kinase; Catalyzes the reversible transfer of the terminal phosphate of ATP to form a long-chain polyphosphate (polyP); Belongs to the polyphosphate kinase 1 (PPK1) family.
Nmlp_3746 protein networkhttps://string-db.org/network/268739.Nmlp_3746Metallophosphoesterase domain protein.
Nmlp_3747 protein networkhttps://string-db.org/network/268739.Nmlp_3747Uncharacterized protein.
Nmlp_3748 protein networkhttps://string-db.org/network/268739.Nmlp_3748HTH-10 family transcription regulator.
Nmlp_3749 protein networkhttps://string-db.org/network/268739.Nmlp_3749HTH domain protein.
gufA2 protein networkhttps://string-db.org/network/268739.Nmlp_3750GufA family transport protein (probable substrate zinc).
Nmlp_3751 protein networkhttps://string-db.org/network/268739.Nmlp_3751IclR family transcription regulator.
valS protein networkhttps://string-db.org/network/268739.Nmlp_3753valine--tRNA ligase; Catalyzes the attachment of valine to tRNA(Val). As ValRS can inadvertently accommodate and process structurally similar amino acids such as threonine, to avoid such errors, [...]
Nmlp_3754 protein networkhttps://string-db.org/network/268739.Nmlp_3754EstB-type esterase domain protein.
Nmlp_3755 protein networkhttps://string-db.org/network/268739.Nmlp_3755Uncharacterized protein.
Nmlp_3756 protein networkhttps://string-db.org/network/268739.Nmlp_3756Probable oxidoreductase (aldo-keto reductase family protein).
Nmlp_3757 protein networkhttps://string-db.org/network/268739.Nmlp_3757MATE efflux family protein.
Nmlp_3758 protein networkhttps://string-db.org/network/268739.Nmlp_3758HAD superfamily hydrolase.
Nmlp_3759 protein networkhttps://string-db.org/network/268739.Nmlp_3759Beta-lactamase domain protein.
Nmlp_3760 protein networkhttps://string-db.org/network/268739.Nmlp_3760Uncharacterized protein.
Nmlp_3761 protein networkhttps://string-db.org/network/268739.Nmlp_3761UspA domain protein.
Nmlp_3762 protein networkhttps://string-db.org/network/268739.Nmlp_3762Uncharacterized protein.
Nmlp_3763 protein networkhttps://string-db.org/network/268739.Nmlp_3763Uncharacterized protein.
degP protein networkhttps://string-db.org/network/268739.Nmlp_3764Probable periplasmic serine protease.
Nmlp_3765 protein networkhttps://string-db.org/network/268739.Nmlp_3765Uncharacterized protein.
mptD protein networkhttps://string-db.org/network/268739.Nmlp_3766Dihydroneopterin aldolase, archaeal-type; Catalyzes the conversion of 7,8-dihydroneopterin (H2Neo) to 6-hydroxymethyl-7,8-dihydropterin (6-HMD); Belongs to the archaeal dihydroneopterin aldolase [...]
citB protein networkhttps://string-db.org/network/268739.Nmlp_3767Aconitate hydratase.
tif2b2 protein networkhttps://string-db.org/network/268739.Nmlp_3768Translation initiation factor aIF-2 beta subunit.
hisA protein networkhttps://string-db.org/network/268739.Nmlp_37691-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase.
fdx protein networkhttps://string-db.org/network/268739.Nmlp_3770Ferredoxin (2Fe-2S).
Nmlp_3771 protein networkhttps://string-db.org/network/268739.Nmlp_3771DUF2070 family protein.
Nmlp_3772 protein networkhttps://string-db.org/network/268739.Nmlp_3772DUF3194 family protein.
pfdB protein networkhttps://string-db.org/network/268739.Nmlp_3773Prefoldin beta subunit; Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding.
Nmlp_3774 protein networkhttps://string-db.org/network/268739.Nmlp_3774TIGR00268 family protein.
Nmlp_3775 protein networkhttps://string-db.org/network/268739.Nmlp_3775Histidine kinase.
Nmlp_3776 protein networkhttps://string-db.org/network/268739.Nmlp_3776CobC/GpmA family phosphatase.
Nmlp_3777 protein networkhttps://string-db.org/network/268739.Nmlp_3777PQQ repeat protein.
Nmlp_3778 protein networkhttps://string-db.org/network/268739.Nmlp_3778DUF3209 family protein.
cbiX1 protein networkhttps://string-db.org/network/268739.Nmlp_3779Sirohydrochlorin cobaltochelatase.
Nmlp_3780 protein networkhttps://string-db.org/network/268739.Nmlp_3780Uncharacterized protein.
Nmlp_3781 protein networkhttps://string-db.org/network/268739.Nmlp_3781Probable ferredoxin (4Fe-4S).
cbiH2 protein networkhttps://string-db.org/network/268739.Nmlp_3782cobalt-factor-III C17-methyltransferase.
cbiH1 protein networkhttps://string-db.org/network/268739.Nmlp_3783cobalt-factor-III C17-methyltransferase.
cbiG protein networkhttps://string-db.org/network/268739.Nmlp_3784cobalt-precorrin-5A hydrolase.
cbiF protein networkhttps://string-db.org/network/268739.Nmlp_3785Cobalt-precorrin-4 C11-methyltransferase.
cbiL1 protein networkhttps://string-db.org/network/268739.Nmlp_3786cobalt-factor-II C20-methyltransferase; Belongs to the precorrin methyltransferase family.
cbiT protein networkhttps://string-db.org/network/268739.Nmlp_3787cobalt-precorrin-6B C15-methyltransferase (decarboxylating); Catalyzes the methylation of C-15 in cobalt-precorrin-6B followed by the decarboxylation of C-12 to form cobalt-precorrin-7.
adh protein networkhttps://string-db.org/network/268739.Nmlp_3788Alcohol dehydrogenase.
Nmlp_3789 protein networkhttps://string-db.org/network/268739.Nmlp_3789Uncharacterized protein.
Nmlp_3790 protein networkhttps://string-db.org/network/268739.Nmlp_3790AAA-type ATPase domain protein.
Nmlp_3791 protein networkhttps://string-db.org/network/268739.Nmlp_3791Uncharacterized protein.
Nmlp_3792 protein networkhttps://string-db.org/network/268739.Nmlp_3792HTH-10 family transcription regulator.
Nmlp_3793 protein networkhttps://string-db.org/network/268739.Nmlp_3793HTH domain protein.
Nmlp_3794 protein networkhttps://string-db.org/network/268739.Nmlp_3794Small CPxCG-related zinc finger protein.
Nmlp_3795 protein networkhttps://string-db.org/network/268739.Nmlp_3795FMN-binding domain protein.
Nmlp_3796 protein networkhttps://string-db.org/network/268739.Nmlp_3796Uncharacterized protein.
Nmlp_3797 protein networkhttps://string-db.org/network/268739.Nmlp_3797TIGR04031 family protein.
ahbC protein networkhttps://string-db.org/network/268739.Nmlp_3798Fe-coproporphyrin synthase AhbC.
Nmlp_3799 protein networkhttps://string-db.org/network/268739.Nmlp_3799MoaD family protein.
Nmlp_3801 protein networkhttps://string-db.org/network/268739.Nmlp_3801Flavin-containing amine-oxidoreductase.
Nmlp_3802 protein networkhttps://string-db.org/network/268739.Nmlp_3802Probable oxidoreductase (short-chain dehydrogenase family).
Nmlp_3803 protein networkhttps://string-db.org/network/268739.Nmlp_3803Uncharacterized protein.
Nmlp_3804 protein networkhttps://string-db.org/network/268739.Nmlp_3804Uncharacterized protein.
Nmlp_3805 protein networkhttps://string-db.org/network/268739.Nmlp_3805Uncharacterized protein.
Nmlp_3806 protein networkhttps://string-db.org/network/268739.Nmlp_3806ArsR family transcription regulator.
tif5B protein networkhttps://string-db.org/network/268739.Nmlp_3807Translation initiation factor aIF-5B (bacterial-type IF2); Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along w [...]
rnz protein networkhttps://string-db.org/network/268739.Nmlp_3808Ribonuclease Z; Zinc phosphodiesterase, which displays some tRNA 3'- processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA; Belongs [...]
Nmlp_3809 protein networkhttps://string-db.org/network/268739.Nmlp_3809arNOG05511 family protein (AAA-type ATPase core domain protein); Belongs to the AAA ATPase family.
Nmlp_3810 protein networkhttps://string-db.org/network/268739.Nmlp_3810Beta-lactamase domain protein.
Nmlp_3811 protein networkhttps://string-db.org/network/268739.Nmlp_3811ABC-type transport system ATP-binding protein.
Nmlp_3812 protein networkhttps://string-db.org/network/268739.Nmlp_3812ABC-type transport system permease protein.
Nmlp_3813 protein networkhttps://string-db.org/network/268739.Nmlp_3813DUF420 family protein.
Nmlp_3814 protein networkhttps://string-db.org/network/268739.Nmlp_3814Probable COG0212-type thiamine metabolism protein.
Nmlp_3815 protein networkhttps://string-db.org/network/268739.Nmlp_3815Uncharacterized protein.
Nmlp_3816 protein networkhttps://string-db.org/network/268739.Nmlp_3816UPF0272 family protein; Belongs to the LarC family.
glnA protein networkhttps://string-db.org/network/268739.Nmlp_3817Glutamine synthetase.
Nmlp_3818 protein networkhttps://string-db.org/network/268739.Nmlp_3818Lrp/AsnC family transcription regulator.
Nmlp_3819 protein networkhttps://string-db.org/network/268739.Nmlp_3819Uncharacterized protein.
hisH protein networkhttps://string-db.org/network/268739.Nmlp_3820Imidazoleglycerol-phosphate synthase subunit HisH; IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glut [...]
Nmlp_3821 protein networkhttps://string-db.org/network/268739.Nmlp_3821Uncharacterized protein.
udg protein networkhttps://string-db.org/network/268739.Nmlp_3822uracil-DNA glycosylase.
Nmlp_3823 protein networkhttps://string-db.org/network/268739.Nmlp_3823UPF0215 family protein; Belongs to the UPF0215 family.
Nmlp_3824 protein networkhttps://string-db.org/network/268739.Nmlp_3824Uncharacterized protein.
Nmlp_3825 protein networkhttps://string-db.org/network/268739.Nmlp_3825Sensor box histidine kinase.
Nmlp_3826 protein networkhttps://string-db.org/network/268739.Nmlp_3826Beta-lactamase domain protein.
Nmlp_3827 protein networkhttps://string-db.org/network/268739.Nmlp_3827Homolog to cytochrome c-type biogenesis protein.
trxA8 protein networkhttps://string-db.org/network/268739.Nmlp_3828Thioredoxin.
Nmlp_3829 protein networkhttps://string-db.org/network/268739.Nmlp_3829DoxX domain protein.
rps10a protein networkhttps://string-db.org/network/268739.Nmlp_383030S ribosomal protein S10a; Involved in the binding of tRNA to the ribosomes. Belongs to the universal ribosomal protein uS10 family.
tef1a protein networkhttps://string-db.org/network/268739.Nmlp_3831Translation elongation factor aEF-1 alpha subunit; This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis. Belongs to the TRAFAC [...]
hom protein networkhttps://string-db.org/network/268739.Nmlp_3832Homoserine dehydrogenase.
Nmlp_3833 protein networkhttps://string-db.org/network/268739.Nmlp_3833ACT domain protein.
tef2 protein networkhttps://string-db.org/network/268739.Nmlp_3834Translation elongation factor aEF-2; Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (P [...]
Nmlp_3835 protein networkhttps://string-db.org/network/268739.Nmlp_3835Uncharacterized protein.
Nmlp_3836 protein networkhttps://string-db.org/network/268739.Nmlp_3836Uncharacterized protein.
Nmlp_3837 protein networkhttps://string-db.org/network/268739.Nmlp_3837Probable sugar dehydrogenase (homolog to aldose sugar dehydrogenase).
rps7 protein networkhttps://string-db.org/network/268739.Nmlp_383830S ribosomal protein S7; One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit inte [...]
rps12 protein networkhttps://string-db.org/network/268739.Nmlp_383930S ribosomal protein S12; With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits. Belongs to the universal ribosomal protein uS12 [...]
Nmlp_3840 protein networkhttps://string-db.org/network/268739.Nmlp_3840PadR family transcription regulator.
nusA protein networkhttps://string-db.org/network/268739.Nmlp_3841Transcription elongation factor NusA; Participates in transcription termination. Belongs to the NusA family.
rpoA2 protein networkhttps://string-db.org/network/268739.Nmlp_3842DNA-directed RNA polymerase subunit A'; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
rpoA1 protein networkhttps://string-db.org/network/268739.Nmlp_3843DNA-directed RNA polymerase subunit A; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
rpoB1 protein networkhttps://string-db.org/network/268739.Nmlp_3844DNA-directed RNA polymerase subunit B; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
rpoB2 protein networkhttps://string-db.org/network/268739.Nmlp_3845DNA-directed RNA polymerase subunit B''; Belongs to the RNA polymerase beta chain family.
rpoH protein networkhttps://string-db.org/network/268739.Nmlp_3846DNA-directed RNA polymerase subunit H; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...]
pheA protein networkhttps://string-db.org/network/268739.Nmlp_3847Prephenate dehydratase.
Nmlp_3848 protein networkhttps://string-db.org/network/268739.Nmlp_3848Uncharacterized protein.
uvrB protein networkhttps://string-db.org/network/268739.Nmlp_3849UvrABC system protein B; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnorm [...]
Nmlp_3851 protein networkhttps://string-db.org/network/268739.Nmlp_3851Abi/CAAX domain protein.
lon protein networkhttps://string-db.org/network/268739.Nmlp_3852ATP-dependent protease Lon; Belongs to the peptidase S16 family.
nadM protein networkhttps://string-db.org/network/268739.Nmlp_3853Nicotinamide-nucleotide adenylyltransferase.
Nmlp_3854 protein networkhttps://string-db.org/network/268739.Nmlp_3854S-adenosylmethionine hydroxide adenosyltransferase family protein.
Nmlp_3855 protein networkhttps://string-db.org/network/268739.Nmlp_3855Uncharacterized protein.
trm14 protein networkhttps://string-db.org/network/268739.Nmlp_3856tRNA (guanine(6)-N(2))-dimethyltransferase.
Nmlp_3857 protein networkhttps://string-db.org/network/268739.Nmlp_3857Uncharacterized protein.
proC protein networkhttps://string-db.org/network/268739.Nmlp_3858Pyrroline-5-carboxylate reductase; Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline.
proB protein networkhttps://string-db.org/network/268739.Nmlp_3859Glutamate 5-kinase; Catalyzes the transfer of a phosphate group to glutamate to form L-glutamate 5-phosphate.
proA protein networkhttps://string-db.org/network/268739.Nmlp_3860Gamma-glutamyl phosphate reductase; Catalyzes the NADPH-dependent reduction of L-glutamate 5- phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclizat [...]
Nmlp_3861 protein networkhttps://string-db.org/network/268739.Nmlp_3861Uncharacterized protein.
rlmE protein networkhttps://string-db.org/network/268739.Nmlp_386223S rRNA (uridine-2'-O-) methyltransferase; Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit.
Nmlp_3863 protein networkhttps://string-db.org/network/268739.Nmlp_3863Uncharacterized protein.
Nmlp_3864 protein networkhttps://string-db.org/network/268739.Nmlp_3864PIN domain protein.
Nmlp_3865 protein networkhttps://string-db.org/network/268739.Nmlp_3865Uncharacterized protein.
Nmlp_3866 protein networkhttps://string-db.org/network/268739.Nmlp_3866SNF family transport protein.
Nmlp_3867 protein networkhttps://string-db.org/network/268739.Nmlp_3867DUF165 family protein; Involved in the import of queuosine (Q) precursors, required for Q precursor salvage; Belongs to the vitamin uptake transporter (VUT/ECF) (TC 2.A.88) family. Q precursor tr [...]
Nmlp_3868 protein networkhttps://string-db.org/network/268739.Nmlp_3868CopG domain protein.
gatD protein networkhttps://string-db.org/network/268739.Nmlp_3869glutamyl-tRNA(Gln) amidotransferase subunit D; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-t [...]
Nmlp_3870 protein networkhttps://string-db.org/network/268739.Nmlp_3870Uncharacterized protein.
Nmlp_3871 protein networkhttps://string-db.org/network/268739.Nmlp_3871Ubiquitin-like protein.
samp3 protein networkhttps://string-db.org/network/268739.Nmlp_3872Ubiquitin-like modifier protein SAMP3.
Nmlp_3873 protein networkhttps://string-db.org/network/268739.Nmlp_3873Uncharacterized protein.
arcS protein networkhttps://string-db.org/network/268739.Nmlp_3874Archaeosine synthase.
rad3b protein networkhttps://string-db.org/network/268739.Nmlp_3875DNA repair helicase Rad3.
Nmlp_3876 protein networkhttps://string-db.org/network/268739.Nmlp_3876Uncharacterized protein.
Nmlp_3877 protein networkhttps://string-db.org/network/268739.Nmlp_3877NUDIX family hydrolase.
Nmlp_3878 protein networkhttps://string-db.org/network/268739.Nmlp_3878Uncharacterized protein.
dcd protein networkhttps://string-db.org/network/268739.Nmlp_3879dCTP deaminase; Catalyzes the deamination of dCTP to dUTP.
thiN1 protein networkhttps://string-db.org/network/268739.Nmlp_3880HTH domain protein / thiamine-phosphate synthase.
Nmlp_3881 protein networkhttps://string-db.org/network/268739.Nmlp_3881Uncharacterized protein.
thi4 protein networkhttps://string-db.org/network/268739.Nmlp_3882Thiamine thiazole synthase; Involved in the biosynthesis of the thiazole moiety of thiamine. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazo [...]
Nmlp_3883 protein networkhttps://string-db.org/network/268739.Nmlp_3883Uncharacterized protein.
thiDN protein networkhttps://string-db.org/network/268739.Nmlp_3884Phosphomethylpyrimidine kinase / phosphomethylpyrimidine phosphate kinase / thiamine-phosphate synthase.
Nmlp_3885 protein networkhttps://string-db.org/network/268739.Nmlp_3885Uncharacterized protein.
mutS1b protein networkhttps://string-db.org/network/268739.Nmlp_3886DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA.
mutL protein networkhttps://string-db.org/network/268739.Nmlp_3887DNA mismatch repair protein MutL; This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a 'molecular matchm [...]
Nmlp_3888 protein networkhttps://string-db.org/network/268739.Nmlp_3888MATE efflux family protein.
pheT protein networkhttps://string-db.org/network/268739.Nmlp_3889phenylalanine--tRNA ligase beta subunit.
pheS protein networkhttps://string-db.org/network/268739.Nmlp_3890phenylalanine--tRNA ligase alpha subunit.
Nmlp_3891 protein networkhttps://string-db.org/network/268739.Nmlp_3891Uncharacterized protein.
Nmlp_3892 protein networkhttps://string-db.org/network/268739.Nmlp_3892Uncharacterized protein.
Nmlp_3893 protein networkhttps://string-db.org/network/268739.Nmlp_3893Uncharacterized protein.
Nmlp_3894 protein networkhttps://string-db.org/network/268739.Nmlp_3894Uncharacterized protein.
cheY2 protein networkhttps://string-db.org/network/268739.Nmlp_3895Response regulator CheY.
Nmlp_3896 protein networkhttps://string-db.org/network/268739.Nmlp_3896Alpha/beta hydrolase fold protein.
Nmlp_3897 protein networkhttps://string-db.org/network/268739.Nmlp_3897Uncharacterized protein.
parA1 protein networkhttps://string-db.org/network/268739.Nmlp_3898ParA domain protein.
Nmlp_3900 protein networkhttps://string-db.org/network/268739.Nmlp_3900Uncharacterized protein.
Nmlp_3901 protein networkhttps://string-db.org/network/268739.Nmlp_3901Uncharacterized protein.
tuc1 protein networkhttps://string-db.org/network/268739.Nmlp_3902Putative tRNA 2-thiolation protein.
ftsZ2 protein networkhttps://string-db.org/network/268739.Nmlp_3903Cell division protein FtsZ, type II; Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly control [...]
Nmlp_3904 protein networkhttps://string-db.org/network/268739.Nmlp_3904CopG domain protein.
Nmlp_3905 protein networkhttps://string-db.org/network/268739.Nmlp_3905DZR domain protein.
Nmlp_3909 protein networkhttps://string-db.org/network/268739.Nmlp_3909Uncharacterized protein; Gene has a frameshift; locus_tag: Nmlp_3908; product: uncharacterized protein (nonfunctional).
Nmlp_3910 protein networkhttps://string-db.org/network/268739.Nmlp_3910Cupin 2 barrel domain protein.
Nmlp_3911 protein networkhttps://string-db.org/network/268739.Nmlp_3911Alpha/beta hydrolase fold protein.
Nmlp_3912 protein networkhttps://string-db.org/network/268739.Nmlp_3912Small CPxCG-related zinc finger protein.
Nmlp_3913 protein networkhttps://string-db.org/network/268739.Nmlp_3913Uncharacterized protein.
grx1 protein networkhttps://string-db.org/network/268739.Nmlp_3914Glutaredoxin.
Nmlp_3915 protein networkhttps://string-db.org/network/268739.Nmlp_3915Uncharacterized protein.
hemL protein networkhttps://string-db.org/network/268739.Nmlp_3916Glutamate-1-semialdehyde 2,1-aminomutase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. HemL subfamily.
Nmlp_3917 protein networkhttps://string-db.org/network/268739.Nmlp_3917Lrp/AsnC family transcription regulator.
amtB1 protein networkhttps://string-db.org/network/268739.Nmlp_3918Transport protein (probable substrate ammonium); Belongs to the P(II) protein family.
hemB protein networkhttps://string-db.org/network/268739.Nmlp_3919Porphobilinogen synthase; Belongs to the ALAD family.
ogt protein networkhttps://string-db.org/network/268739.Nmlp_3920Probable methylated-DNA--protein-cysteine methyltransferase.
Nmlp_3921 protein networkhttps://string-db.org/network/268739.Nmlp_3921Uncharacterized protein.
Nmlp_3922 protein networkhttps://string-db.org/network/268739.Nmlp_3922DUF3426 domain protein.
Nmlp_3923 protein networkhttps://string-db.org/network/268739.Nmlp_3923Small CPxCG-related zinc finger protein.
sec11 protein networkhttps://string-db.org/network/268739.Nmlp_3924Signal peptidase I.
phaC protein networkhttps://string-db.org/network/268739.Nmlp_3925Poly(3-hydroxyalkanoate) synthase PhaC.
phaE protein networkhttps://string-db.org/network/268739.Nmlp_3926Poly(3-hydroxyalkanoate) synthase PhaE.
Nmlp_3927 protein networkhttps://string-db.org/network/268739.Nmlp_3927arCOG06342 family protein.
Nmlp_3928 protein networkhttps://string-db.org/network/268739.Nmlp_3928PHA granule-associated 12K protein.
phaJ protein networkhttps://string-db.org/network/268739.Nmlp_3929(R)-specific enoyl-CoA hydratase.
Nmlp_3930 protein networkhttps://string-db.org/network/268739.Nmlp_3930Uncharacterized protein.
CEK41125.1 protein networkhttps://string-db.org/network/268739.Nmlp_3930ASmall CPxCG-related zinc finger protein.
cgi121 protein networkhttps://string-db.org/network/268739.Nmlp_3931KEOPS complex subunit Cgi121.
hel308a protein networkhttps://string-db.org/network/268739.Nmlp_3932ATP-dependent DNA helicase Hel308; DNA-dependent ATPase and 3'-5' DNA helicase that may be involved in repair of stalled replication forks.
Nmlp_3933 protein networkhttps://string-db.org/network/268739.Nmlp_3933Receiver/sensor box histidine kinase.
ferC protein networkhttps://string-db.org/network/268739.Nmlp_3934Ferredoxin (4Fe-4S).
mdh protein networkhttps://string-db.org/network/268739.Nmlp_3935Malate dehydrogenase; Belongs to the LDH/MDH superfamily.
uvrA protein networkhttps://string-db.org/network/268739.Nmlp_3936UvrABC system protein A; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of 2 [...]
polD1 protein networkhttps://string-db.org/network/268739.Nmlp_3937DNA-directed DNA polymerase D exonuclease subunit DP1; Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3' to 5' dire [...]
Nmlp_3938 protein networkhttps://string-db.org/network/268739.Nmlp_3938Uncharacterized protein.
Nmlp_3939 protein networkhttps://string-db.org/network/268739.Nmlp_3939Uncharacterized protein.
Nmlp_3940 protein networkhttps://string-db.org/network/268739.Nmlp_3940DUF296 family protein.
polD2 protein networkhttps://string-db.org/network/268739.Nmlp_3941DNA-directed DNA polymerase D large subunit (intein-containing); Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- [...]
Nmlp_3944 protein networkhttps://string-db.org/network/268739.Nmlp_3944Uncharacterized protein.
Nmlp_3945 protein networkhttps://string-db.org/network/268739.Nmlp_3945Uncharacterized protein.
hcp3 protein networkhttps://string-db.org/network/268739.Nmlp_3945AHalocyanin.
mutS5a protein networkhttps://string-db.org/network/268739.Nmlp_3947DNA mismatch repair protein MutS; Has ATPase and non-specific DNA-binding activities. Belongs to the DNA mismatch repair MutS family. Archaeal Muts2 subfamily.
orc2 protein networkhttps://string-db.org/network/268739.Nmlp_3948Orc1-type DNA replication protein; Involved in regulation of DNA replication.